close all open/close all

CDS information : Adria_00020


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction19,180 / 18,353 / - [in whole cluster]
2,175 / 1,348 / - [in contig]
Locationcomplement(18353..19180) [in whole cluster]
complement(1348..2175) [in contig]
TypeCDS
Length828 bp (275 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productdoxorubicin biosynthesis protein
Product (GenBank)doxorubicin biosynthesis enzyme DnrV
Gene
Gene (GenBank)dnrV
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>doxorubicin biosynthesis protein [doxorubicin biosynthesis enzyme DnrV]
MTRFAPGAPAWFDLGSPDVAASADFYTGLFGWTATVVSDPGAGGYTTFSSDGKLVAAVAR
HQIDTPYHRPYGPGNDQHGMPAIWTVYFATDDADALTKRVETAGGEVIMTPMDVLGLGRM
AVFADPAGAAFAVWRKGVMEGAEVTGVPGSVGWVELVTDGIGAARDFYPATLGLAPADTG
LKGVTDPVWHIGDTPVAGTQELGVTGAVRPHWAVLFAVHDCDATVRRAVELGGSVENEPA
DTPRGRRADLLDPHGAGFSVVELREGYPAAAGGAS
selected fasta
>doxorubicin biosynthesis protein [doxorubicin biosynthesis enzyme DnrV]
GTGACCAGGTTCGCGCCCGGCGCCCCCGCATGGTTCGACCTCGGTTCGCCCGATGTCGCC
GCCTCGGCCGACTTCTACACCGGCCTGTTCGGCTGGACCGCCACCGTGGTCAGCGACCCG
GGCGCCGGGGGATACACGACGTTCAGCTCCGACGGGAAGCTGGTCGCCGCGGTCGCCCGC
CACCAGATCGACACCCCCTACCACCGGCCGTACGGGCCCGGGAACGACCAGCACGGCATG
CCGGCCATCTGGACCGTGTACTTCGCCACCGACGACGCCGACGCACTGACCAAGCGGGTC
GAGACGGCGGGCGGCGAGGTCATCATGACTCCGATGGACGTCCTCGGCCTCGGCCGGATG
GCGGTCTTCGCCGACCCCGCCGGGGCCGCGTTCGCGGTCTGGCGCAAGGGAGTCATGGAG
GGCGCGGAGGTGACGGGCGTGCCCGGCTCGGTCGGCTGGGTCGAGCTGGTGACCGACGGC
ATCGGGGCCGCCCGGGACTTCTACCCGGCGACCCTCGGCCTGGCTCCGGCCGACACCGGA
CTGAAGGGCGTCACCGACCCGGTCTGGCACATCGGTGACACACCGGTCGCCGGCACCCAG
GAGCTGGGCGTCACCGGCGCGGTACGGCCGCACTGGGCCGTGCTGTTCGCCGTGCACGAC
TGCGACGCGACGGTCCGGCGCGCCGTTGAACTCGGCGGCTCCGTCGAGAACGAGCCCGCC
GACACGCCCAGGGGGCGGCGGGCGGACCTGCTCGACCCGCACGGGGCCGGCTTCTCGGTG
GTCGAACTGCGGGAGGGGTACCCCGCGGCGGCGGGCGGTGCCTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain (Domain)
 [14-131]  2.2e-10 PF00903
PF00903   Glyoxalase
IPR025870 Glyoxalase-like domain (Domain)
 [160-259]  9.8e-09 PF12681
PF12681   Glyoxalase_2
SignalP
 [1-22]  0.307 Signal
Bacteria, Gram-positive   
 [1-10]  0.509 Signal
Bacteria, Gram-negative   
TMHMM No significant hit