close all open/close all

CDS information : Adria_00030


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction20,147 / 19,284 / - [in whole cluster]
3,142 / 2,279 / - [in contig]
Locationcomplement(19284..20147) [in whole cluster]
complement(2279..3142) [in contig]
TypeCDS
Length864 bp (287 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)daunorubicin C-13 ketoreductase
Gene
Gene (GenBank)dnrU
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [daunorubicin C-13 ketoreductase]
MTASTPHHGTPRGGLSGRTVLVTGATSGIGRAAALAVARQGARVVLVGRDPERLRTVTNE
VARTAGPAPDAFRADFAELRQVRDLGERLRDRYPRIDVMASNAGGMFWSRTTTQDGFEAT
IQVNHLAGFLLARLLRERLAGGRLILTSSDAYTQGRIDPDDLNGDRHRYSAGQAYGTSKQ
ANIMTAAEAARRWPDVLAVSYHPGEVRTRIGRGTVASSYFRFNPFLRSAAKGADTLVWLA
SAPAEELTTGGYYSDRRLSPVSGPTADAGLAAKLWEAGAAAVGDTAH
selected fasta
>putative oxidoreductase [daunorubicin C-13 ketoreductase]
ATGACGGCCTCCACCCCGCACCACGGGACACCACGCGGCGGCCTGTCGGGCCGGACGGTG
CTGGTCACCGGGGCCACGTCCGGCATCGGCCGGGCGGCGGCCCTCGCGGTCGCCCGCCAG
GGGGCCCGCGTCGTGCTCGTCGGCCGGGACCCCGAGCGTCTGCGGACCGTCACGAACGAG
GTGGCCCGGACCGCCGGCCCGGCCCCGGACGCCTTCCGCGCGGACTTCGCCGAGCTGCGC
CAGGTACGCGACCTGGGGGAGCGGCTGCGGGACCGGTACCCGCGCATCGATGTCATGGCC
AGCAACGCCGGCGGCATGTTCTGGTCGCGCACCACGACCCAGGACGGGTTCGAGGCCACC
ATCCAGGTCAATCACCTCGCAGGCTTCCTGCTGGCACGGCTGCTGCGGGAGCGGCTCGCG
GGCGGGCGGCTGATCCTCACCTCGTCCGACGCGTACACCCAGGGCCGGATCGACCCGGAC
GACCTCAACGGCGACCGTCACCGCTACAGCGCCGGCCAGGCGTACGGCACGTCCAAACAG
GCCAACATCATGACCGCGGCGGAGGCCGCCAGGCGCTGGCCGGACGTGCTGGCGGTCAGC
TATCACCCCGGTGAGGTCCGCACCCGCATCGGACGGGGCACGGTCGCCTCGTCCTACTTC
CGGTTCAACCCCTTCCTGCGCTCCGCGGCGAAGGGCGCCGACACCCTCGTGTGGCTGGCG
TCCGCGCCGGCCGAGGAGTTGACCACGGGCGGCTACTACAGCGACCGGCGGCTGTCCCCG
GTGAGCGGCCCGACCGCCGACGCCGGCCTCGCGGCGAAGCTCTGGGAGGCCGGCGCGGCC
GCCGTCGGCGACACCGCGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [19-155]  8.89999999999994e-20 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [19-36]  4.19999771339581e-08 PR00081 [94-105]  4.19999771339581e-08 PR00081 [136-152]  4.19999771339581e-08 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [11-276]  7.20000000000002e-51 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-34]  0.64 Signal
Eukaryota   
TMHMM No significant hit