close all open/close all

CDS information : Adria_00040


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction20,398 / 20,144 / - [in whole cluster]
3,393 / 3,139 / - [in contig]
Locationcomplement(20144..20398) [in whole cluster]
complement(3139..3393) [in contig]
TypeCDS
Length255 bp (84 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)daunorubicin acyl carrier protein
Gene
Gene (GenBank)dpsG
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • component of daunorubicin/doxorubicin polyketide synthase
Reference
ACC
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
Related Reference
ACC
Q53878
NITE
Dauno_00020
PmId
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

ACP5..77

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [daunorubicin acyl carrier protein]
MAELSLAELREIMRQSLGEDEVPDLADADTVTFEDLGLDSLAVLETVNHIERTYGVKLPE
EELAEVRTPHSMLIFVNERLRAAA
selected fasta
>polyketide synthase acyl carrier protein subunit [daunorubicin acyl carrier protein]
ATGGCTGAGCTCAGCCTGGCGGAACTGCGGGAGATCATGCGGCAGAGCCTGGGGGAGGAC
GAGGTCCCCGACCTTGCGGACGCGGACACCGTGACCTTCGAGGACCTCGGGCTCGACTCC
CTGGCCGTCCTGGAAACGGTCAACCACATCGAGCGGACCTATGGCGTGAAGCTGCCCGAG
GAGGAACTGGCGGAGGTCAGGACGCCGCATAGCATGCTGATCTTCGTCAACGAGAGGCTG
CGAGCGGCGGCATGA
ACP5..77
ACP13..231

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [35-50]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [8-73]  6.60000000000002e-13 PF00550
PF00550   PP-binding
 [1-80]  6.59999852526375e-14 SSF47336
SSF47336   ACP_like
 [5-77]  PS50075
PS50075   ACP_DOMAIN
 [6-81]  2.4e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
SignalP
 [1-18]  0.074 Signal
Eukaryota   
 [1-28]  0.081 Signal
Bacteria, Gram-positive   
TMHMM No significant hit