close all open/close all

CDS information : Adria_00050


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction20,498 / 21,082 / + [in whole cluster]
3,493 / 4,077 / + [in contig]
Location20498..21082 [in whole cluster]
3493..4077 [in contig]
TypeCDS
Length585 bp (194 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)daunorubicin biosynthesis enzyme
GenednmW
Gene (GenBank)dpsH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8955419] Enhanced antibiotic production by manipulation of the Streptomyces peucetius dnrH and dnmT genes involved in doxorubicin (adriamycin) biosynthesis. (J Bacteriol. , 1996)
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
Related Reference
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [daunorubicin biosynthesis enzyme]
MDRRLSALPQDARNRLGTAPAGRRTRPGQDRAARGHHTTQGVTMDALPADDAPTTESADC
TDPGIYLQVQRFYARQMQLLDDGRAEDWARTFAQDGVFEVGGEAVRGAADIARAARRTTD
RFAAEGITRRHWIGMLTVDGKPDEVTARSYAVVLETPRDGDPVLRRSTVCTDILVREAGE
WRVKHRTVTRDGLD
selected fasta
>hypothetical protein [daunorubicin biosynthesis enzyme]
GTGGACCGACGGTTGTCCGCTCTGCCTCAAGACGCGCGGAACAGGTTGGGCACGGCGCCG
GCCGGCAGGCGCACGCGGCCGGGCCAGGACCGGGCCGCCCGAGGCCATCACACGACCCAA
GGGGTAACCATGGACGCGCTCCCGGCGGACGACGCGCCGACGACCGAGTCGGCGGATTGT
ACGGACCCCGGCATCTACCTCCAGGTACAGCGGTTCTACGCCCGGCAGATGCAACTCCTG
GATGACGGCAGGGCCGAGGACTGGGCGCGCACGTTCGCGCAGGACGGCGTCTTCGAGGTG
GGCGGCGAGGCCGTCCGCGGGGCCGCGGACATCGCGCGTGCGGCACGGCGGACCACGGAC
CGGTTCGCCGCCGAAGGGATCACCCGGCGGCACTGGATCGGCATGCTGACCGTCGACGGC
AAGCCCGACGAGGTCACGGCCCGCAGCTACGCGGTGGTGCTGGAGACGCCGCGCGACGGC
GACCCGGTGTTGCGCCGCAGCACGGTGTGCACGGACATCCTGGTGCGGGAGGCGGGCGAG
TGGCGCGTCAAACACCGCACCGTCACCCGGGACGGGCTGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit