close all open/close all

CDS information : Adria_00060


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction21,134 / 22,651 / + [in whole cluster]
4,129 / 5,646 / + [in contig]
Location21134..22651 [in whole cluster]
4129..5646 [in contig]
TypeCDS
Length1,518 bp (505 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)doxorubicin biosynthesis protein DnmT
Gene
Gene (GenBank)dnmT
EC number
Keyword
  • daunosamine
Note
Note (GenBank)
  • catalyzes unknown step in biosynthesis of daunosamine, an intermediate of doxorubicin biosynthesis; deoxysugar biosynthesis enzyme
Reference
ACC
PmId
[8955419] Enhanced antibiotic production by manipulation of the Streptomyces peucetius dnrH and dnmT genes involved in doxorubicin (adriamycin) biosynthesis. (J Bacteriol. , 1996)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [doxorubicin biosynthesis protein DnmT]
MTAQIARSVLARDGLGSGMDRFWAWYADRSAQVVHRTERIPLDDLKGWSRHPVTGTVSHH
TGRFFSIEGLDVHIPGAPVPRWSQPIVNQPEVGILGFLVKERHGVLHCLVQAKFEPGNPG
GLQLSPTVQATRSNYTRVHGGKAIPYLEHFRDTAERQVVADVLQSEQGSWFYRKRNRNMI
VQVIDEVPLHEDFHWLTLGQLHRLLGVENLVNMDARTVLACLPFASEGAHPLADAEPAGA
DGPGGGHPVVPARPDGGEGRVDTGFHRSLVRSCAAAEGSLHSTVDIVSWIADLRSRTDVV
TRPAALNALPHWYERDGAIAHESGRFLEVMAVDVTAASREVPGWSQPMIEPKDQGVAAFL
VRRIDGVLHVLAHARVEPGYVDVVEIAPTVQCTPGSLHALPAEARPRFLDAVLEAPPERV
RYATVLAEEGGRFYHAVNTYMIVEADHDIPDGGEYRWLTLHQLVGLLRHSHYVNVQARTL
VACLHSLSVGSPVTRSAVPSAPPRR
selected fasta
>putative NDP-hexose 2,3-dehydratase [doxorubicin biosynthesis protein DnmT]
ATGACCGCCCAGATCGCCCGGTCCGTCCTCGCCCGGGACGGCCTGGGCAGCGGCATGGAC
CGTTTCTGGGCGTGGTACGCCGACCGCTCGGCGCAGGTCGTGCACCGCACCGAGCGGATT
CCGCTGGACGACCTCAAGGGGTGGAGCCGCCACCCGGTCACTGGGACCGTCTCCCATCAC
ACCGGGAGGTTCTTCAGCATCGAGGGACTGGACGTGCACATCCCGGGCGCCCCCGTGCCA
CGCTGGTCCCAGCCGATCGTGAACCAGCCCGAGGTGGGCATCCTCGGCTTCCTGGTGAAG
GAGCGCCACGGGGTCCTGCACTGCCTCGTCCAGGCCAAGTTCGAGCCGGGCAACCCCGGC
GGGCTTCAGCTCTCCCCTACGGTCCAGGCCACCCGCAGCAACTACACGCGGGTGCACGGC
GGCAAGGCCATCCCGTACCTGGAGCACTTCCGCGACACCGCCGAACGGCAGGTGGTCGCC
GATGTGCTCCAGTCCGAACAGGGCTCCTGGTTCTACCGCAAGCGCAACCGCAACATGATC
GTCCAAGTGATCGACGAGGTCCCGCTGCACGAGGACTTCCACTGGCTGACGCTGGGTCAG
CTGCACCGGCTGCTGGGGGTCGAGAACCTCGTGAACATGGACGCCAGGACGGTGCTGGCC
TGCCTGCCGTTCGCGAGTGAGGGAGCGCACCCGCTGGCCGACGCGGAGCCGGCCGGAGCC
GACGGCCCCGGAGGTGGCCACCCGGTGGTCCCCGCTCGACCCGACGGCGGCGAGGGCCGG
GTAGACACCGGTTTCCACCGCTCCCTCGTGCGGTCGTGCGCGGCGGCCGAGGGCAGCCTG
CACAGCACCGTGGACATCGTCAGCTGGATCGCCGACCTGCGCAGCCGTACCGACGTGGTC
ACCCGCCCGGCTGCGCTGAACGCGCTGCCGCACTGGTACGAGCGGGACGGCGCGATCGCC
CACGAGAGCGGGCGCTTCCTGGAGGTGATGGCCGTCGACGTGACGGCCGCCTCGCGGGAG
GTGCCCGGCTGGAGCCAGCCGATGATCGAACCCAAGGACCAAGGGGTCGCGGCTTTCCTG
GTCCGACGGATCGACGGGGTTCTCCACGTCCTGGCGCACGCGCGCGTGGAGCCCGGCTAC
GTCGACGTGGTGGAGATCGCGCCCACCGTACAGTGCACCCCCGGCAGTCTGCACGCCCTG
CCCGCCGAGGCCAGGCCCCGCTTCCTCGACGCCGTGCTGGAGGCTCCACCCGAGCGCGTG
CGCTACGCGACCGTCCTCGCGGAGGAGGGAGGGCGCTTCTACCACGCGGTGAACACCTAC
ATGATCGTCGAAGCCGACCATGACATCCCGGACGGTGGCGAATACCGCTGGCTGACGCTC
CACCAACTGGTCGGGCTGCTGCGTCACTCCCACTACGTCAACGTCCAGGCCCGCACCCTG
GTCGCCTGTCTGCACAGCCTGTCCGTGGGCTCGCCCGTAACCCGCTCAGCCGTGCCGTCC
GCCCCGCCCCGGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [20-222]  1.79999999999997e-82 PF03559 [281-484]  1.79999999999997e-79 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-11]  0.417 Signal
Bacteria, Gram-negative   
TMHMM No significant hit