close all open/close all

CDS information : Adria_00070


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction22,659 / 23,990 / + [in whole cluster]
5,654 / 6,985 / + [in contig]
Location22659..23990 [in whole cluster]
5654..6985 [in contig]
TypeCDS
Length1,332 bp (443 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycosyltransferase
Product (GenBank)putative baumycin biosynthesis protein
Gene
Gene (GenBank)dnrH
EC number
Keyword
  • baumycin
Note
Note (GenBank)
  • catalyzes formation of baumycins, C-4' glycosides of doxorubicin; putative glycosyl transferase; DnrH
Reference
ACC
PmId
[8955419] Enhanced antibiotic production by manipulation of the Streptomyces peucetius dnrH and dnmT genes involved in doxorubicin (adriamycin) biosynthesis. (J Bacteriol. , 1996)
[23885759] Nitrososynthase-triggered oxidative carbon-carbon bond cleavage in baumycin biosynthesis. (J Am Chem Soc. , 2013)
Related Reference
ACC
Q9ZGH7
NITE
Pikro_00090
PmId
[15161264] Characterization of the glycosyltransferase activity of desVII: analysis of and implications for the biosynthesis of macrolide antibiotics. (J Am Chem Soc. , 2004)
[15358425] New olivosyl derivatives of methymycin/pikromycin from an engineered strain of Streptomyces venezuelae. (FEMS Microbiol Lett. , 2004)
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[23770075] Combinatorial biosynthesis and antibacterial evaluation of glycosylated derivatives of 12-membered macrolide antibiotic YC-17. (J Biotechnol. , 2013)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative glycosyltransferase [putative baumycin biosynthesis protein]
MRVLFATMAARSHVYAQVTLASALRTAGHEVLVASQPDVLDDIVRAGLTAVRIGEDLNIE
EETREANASFEDDRNLGGLAMSNSRDDPFPWDHALGMFTAMTAMVFQNVCPEPMVDDLVG
LARDWRPDLVVWDPLTLAGPVAARLSGAAHARLLFGPDQMGRNRTAFRALLDRQPPELRD
DPLAEWLTWTLERCGGSAGDMSEELVLGQWTIDPTPPSMRIPLDLPCVPVRYVPYNGPSL
LPGWLREPPRHPRRLCLTLGVSLGEATGAGTVAASDVLAAVDGLDVEVVATLPRELREEL
GTLPANVRAVDFVPLNALLPSCSGIIHHGGSGTFMTALVHAIPQLIVPDMMWDAMEKAHG
LARSGAGSYVDARDVSPELLRERVLALLDDPSYAAGARRVRAEIVGTPSPNDIVPVLERL
TAEHRAGGAEGGPALKSPSTGGA
selected fasta
>putative glycosyltransferase [putative baumycin biosynthesis protein]
GTGCGCGTCCTGTTCGCCACCATGGCCGCGCGGTCCCATGTCTACGCCCAGGTCACCCTG
GCGTCGGCACTGCGGACCGCGGGGCACGAAGTGCTCGTGGCCAGCCAGCCCGACGTCCTC
GACGACATCGTCCGGGCCGGTCTCACCGCCGTGCGGATCGGGGAGGACCTCAACATCGAG
GAGGAGACCCGGGAGGCCAACGCCAGCTTCGAGGACGACCGCAACCTCGGGGGCCTCGCC
ATGAGCAACTCCCGTGATGACCCCTTCCCGTGGGACCACGCGCTCGGCATGTTCACCGCG
ATGACCGCCATGGTCTTCCAGAACGTGTGCCCCGAGCCCATGGTCGACGACCTCGTCGGC
CTCGCCCGCGACTGGCGGCCGGACCTCGTGGTCTGGGATCCGCTGACCCTGGCCGGGCCG
GTGGCCGCCCGGCTCAGCGGGGCGGCGCACGCCCGGCTGCTGTTCGGCCCGGACCAGATG
GGCCGGAACAGGACGGCGTTCCGCGCCCTGCTCGACCGGCAACCGCCCGAGCTGCGCGAC
GACCCGCTGGCCGAGTGGCTCACCTGGACGCTGGAGCGGTGCGGCGGCAGCGCCGGGGAC
ATGAGCGAGGAGCTGGTCCTCGGGCAGTGGACGATCGACCCCACACCGCCGTCGATGCGC
ATCCCCCTGGACCTGCCCTGCGTGCCGGTGCGCTACGTGCCGTACAACGGGCCCTCCCTG
CTCCCCGGCTGGCTGCGCGAGCCGCCCCGCCACCCGCGGCGCCTGTGCCTGACGCTCGGT
GTGTCCCTCGGCGAGGCGACGGGCGCCGGCACGGTCGCCGCCTCCGACGTCCTGGCGGCC
GTGGACGGCCTGGACGTGGAGGTCGTCGCCACCCTGCCGCGGGAACTGCGCGAGGAGCTC
GGCACCCTGCCGGCGAACGTGCGGGCCGTGGACTTCGTCCCGCTGAACGCCCTGCTGCCG
TCCTGCTCGGGCATCATCCATCACGGCGGGTCCGGCACGTTCATGACGGCCCTGGTGCAC
GCGATACCGCAGCTGATCGTGCCTGACATGATGTGGGACGCCATGGAGAAGGCACACGGC
CTGGCCCGCAGCGGTGCGGGCAGTTACGTGGACGCGCGGGACGTCTCGCCGGAACTGCTG
CGCGAGCGCGTCCTCGCCCTGCTCGACGATCCGTCCTACGCCGCCGGGGCACGCCGGGTG
CGCGCCGAGATCGTCGGGACGCCGAGCCCGAACGACATCGTGCCCGTGCTGGAGCGGCTG
ACCGCCGAGCACCGGGCCGGCGGGGCGGAGGGGGGCCCGGCGCTCAAGTCGCCTTCCACC
GGCGGTGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-64]  5.5e-10 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [212-308]  4.9e-32 PF06722
PF06722   DUF1205
SignalP
 [1-16]  0.578 Signal
Bacteria, Gram-negative   
 [1-16]  0.933 Signal
Eukaryota   
 [1-23]  0.352 Signal
Bacteria, Gram-positive   
TMHMM No significant hit