close all open/close all
first first   Adria_00090 Adria_00090

CDS information : Adria_00080


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction655 / 1,710 / + [in whole cluster]
655 / 1,710 / + [in contig]
Location655..1710 [in whole cluster]
655..1710 [in contig]
TypeCDS
Length1,056 bp (351 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)glucose-1-phosphate thymidylyltransferase
GenednmL
Gene (GenBank)dnrL
EC number2.7.7.24
Keyword
  • daunosamine
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[8932700] The dnrM gene in Streptomyces peucetius contains a naturally occurring frameshift mutation that is suppressed by another locus outside of the daunorubicin-production gene cluster. (Microbiology. , 1996)
Related Reference
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [glucose-1-phosphate thymidylyltransferase]
MKALVLSGGSGTRLRPFTHTSPKQLVPVANKPVLYYVLEDIAQASITEVGIVVGETSNEI
RKAVGSGDRFGLRVTYLPQEAPLGLAHAVLIARDYLGEEDFVMYLGDNFVVGGIAGNSST
FRAERPDAQILLTRVSDPSSFGVAEIGCDGRVVALEEKPRHPRSDLAVVGIYLFTPVVHE
AVRALTPSRRGELEITDALQWLLDGPYDVRYTTISGYWKDTGNVADMLEVNRAVLDGIEP
GMEGQADAASELVGRVRIEAGAQIRASRIVARRHRAGRVTDRTSALHVDRGDCSIETARS
SLHHAGRLPAHGTRRVQHSLLGRNVTVAPAPRVPAGSRLILGDDSRVEISS
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [glucose-1-phosphate thymidylyltransferase]
ATGAAGGCTCTCGTCCTGTCCGGGGGGTCGGGCACGCGCCTGCGGCCCTTCACACACACG
TCTCCCAAGCAGTTGGTGCCGGTAGCCAACAAGCCGGTCCTCTACTACGTCCTCGAGGAC
ATCGCTCAGGCCAGCATCACCGAGGTCGGCATCGTCGTTGGGGAGACGTCCAACGAGATC
CGCAAGGCCGTCGGGAGCGGCGACAGATTCGGGCTCCGCGTCACCTACCTTCCGCAGGAG
GCGCCCCTGGGTCTGGCTCACGCTGTCCTCATCGCCCGCGACTATCTCGGCGAGGAGGAC
TTCGTCATGTATCTCGGGGACAACTTCGTGGTCGGCGGCATCGCAGGGAACTCGTCGACG
TTCCGCGCGGAGCGCCCCGATGCCCAGATCCTGCTCACCCGTGTCTCCGACCCGTCCAGC
TTCGGCGTGGCCGAGATCGGCTGTGACGGCCGGGTCGTCGCGCTGGAGGAGAAGCCGAGG
CACCCCCGCAGTGATCTCGCCGTGGTCGGGATCTACTTGTTCACGCCGGTCGTGCACGAG
GCGGTGCGCGCCCTCACACCGTCACGGCGGGGCGAGCTGGAAATCACGGACGCCCTCCAG
TGGCTCCTCGACGGACCCTACGACGTGCGGTACACCACCATCTCCGGTTATTGGAAGGAC
ACGGGAAACGTCGCCGACATGCTGGAGGTGAACCGTGCCGTGCTGGACGGGATCGAGCCG
GGCATGGAGGGCCAGGCCGACGCGGCGAGCGAACTGGTGGGGCGGGTGCGGATCGAGGCG
GGCGCGCAGATCCGGGCGTCGCGCATCGTGGCCCGCCGTCATCGGGCCGGACGTGTGACG
GATCGTACGTCGGCCCTACACGTCGATCGCGGAGACTGCTCGATCGAGACAGCGAGATCG
AGTCTCCATCATGCTGGGCGACTCCCGGCTCACGGCACGCGCCGGGTCCAGCACTCGCTC
CTGGGGCGGAACGTGACCGTCGCTCCGGCCCCCCGGGTACCCGCAGGTTCCCGTCTCATC
CTCGGTGACGACAGCAGGGTGGAGATCTCCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-236]  1.80000000000002e-56 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-348]  1.69999999999998e-109 TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit
first first   Adria_00090 Adria_00090