close all open/close all

CDS information : Adria_00090


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction1,707 / 1,892 / + [in whole cluster]
1,707 / 1,892 / + [in contig]
Location1707..1892 [in whole cluster]
1707..1892 [in contig]
TypeCDS
Length186 bp (61 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productputative dTDP-glucose 4,6-dehydratase(fragment)
Product (GenBank)
GenednmM
Gene (GenBank)dnrM
EC number
Keyword
Note
  • This ORF may be a truncated form of dTDP-glucose 4,6-dehydratase because of a frameshift mutation.
Note (GenBank)
  • truncated
Reference
ACC
PmId
[8932700] The dnrM gene in Streptomyces peucetius contains a naturally occurring frameshift mutation that is suppressed by another locus outside of the daunorubicin-production gene cluster. (Microbiology. , 1996)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase(fragment)
MTMKILVTGGAGFIGSHYVRALLGPRGDGSVGVTAGQPDLCRQSGQPRSRPRRRAVRLRP
R
selected fasta
>putative dTDP-glucose 4,6-dehydratase(fragment)
ATGACCATGAAGATCCTGGTGACAGGCGGTGCCGGCTTCATCGGCTCGCACTACGTCCGC
GCCCTGCTCGGCCCGCGCGGCGACGGCTCGGTCGGGGTCACTGCTGGACAGCCTGACCTA
TGCAGGCAATCCGGCCAACCTCGATCCCGTCCGCGGCGACGAGCGGTTCGCCTTCGTCCA
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-28]  2.3e-05 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [1-24]  5.2e-08 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-21]  0.695 Signal
Eukaryota   
 [1-21]  0.933 Signal
Bacteria, Gram-negative   
TMHMM No significant hit