close all open/close all

CDS information : Adria_00100


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction3,333 / 2,725 / - [in whole cluster]
651 / 43 / - [in contig]
Locationcomplement(2725..3333) [in whole cluster]
complement(43..651) [in contig]
TypeCDS
Length609 bp (202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)regulatory protein
Gene
Gene (GenBank)dnrN
EC number
Keyword
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7868594] Regulation of daunorubicin production in Streptomyces peucetius by the dnrR2 locus. (J Bacteriol. , 1995)
[8892835] The DnrN protein of Streptomyces peucetius, a pseudo-response regulator, is a DNA-binding protein involved in the regulation of daunorubicin biosynthesis. (J Bacteriol. , 1996)
[10846224] The dnrO gene encodes a DNA-binding protein that regulates daunorubicin production in Streptomyces peucetius by controlling expression of the dnrN pseudo response regulator gene. (Microbiology. , 2000)
[20122958] The activator/repressor protein DnrO of Streptomyces peucetius binds to DNA without changing its topology. (Int J Biol Macromol. , 2010)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [regulatory protein]
MTIRVVIAEELEMVRAALVLLVERESDIKVVASTGVGSELIRTVLEYSPDVTVIDVDMHE
REGLLSAMAIQEHLPDCRTLLTARFARLATVRQSLASGLGGLVLKSSPPAHLSDAIRSVH
EGRRVFDTELTLAAWGNTGCPLTEREMEILQLAAAGDDINEIAVKLSLSPGTVRNYLATT
VRKMDARNRLDAVRIASMSGWI
selected fasta
>LuxR family transcriptional activator [regulatory protein]
ATGACCATCCGAGTCGTGATTGCTGAAGAGCTGGAAATGGTCCGTGCCGCGCTGGTTCTC
CTAGTGGAGCGTGAATCGGACATCAAAGTCGTCGCTTCCACAGGCGTCGGCAGCGAGTTG
ATCCGGACGGTTCTGGAGTACAGCCCCGACGTGACGGTCATCGATGTCGACATGCACGAG
CGGGAGGGTCTTCTCTCCGCCATGGCGATTCAGGAGCACCTCCCGGACTGCCGCACACTG
CTCACCGCGCGATTCGCCCGGCTGGCTACAGTGCGCCAGTCGCTGGCATCCGGCCTCGGC
GGCCTGGTGCTGAAGAGCTCCCCTCCGGCGCACCTCAGCGATGCCATACGCAGCGTGCAC
GAGGGCCGCCGCGTCTTCGACACCGAACTGACGCTCGCCGCCTGGGGCAACACCGGATGC
CCGCTCACGGAGCGGGAGATGGAGATACTCCAGCTCGCCGCCGCGGGGGACGACATCAAC
GAAATTGCCGTCAAGCTGTCGCTCTCTCCCGGGACGGTCCGCAACTATCTGGCGACGACC
GTCCGGAAGATGGACGCGCGCAACCGGCTCGACGCGGTACGCATCGCCAGTATGTCCGGC
TGGATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [141-196]  2.6e-16 PF00196
PF00196   GerE
 [142-156]  3.1999989904635e-10 PR00038 [156-172]  3.1999989904635e-10 PR00038 [172-184]  3.1999989904635e-10 PR00038
PR00038   HTHLUXR
 [135-200]  PS50043
PS50043   HTH_LUXR_2
 [139-196]  1.79999754022375e-23 SM00421
SM00421   HTH_LUXR
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [5-116]  7.90000000000001e-11 PF00072
PF00072   Response_reg
 [4-120]  PS50110
PS50110   RESPONSE_REGULATORY
 [3-116]  1.6999992228405e-07 SM00448
SM00448   REC
IPR011006 CheY-like superfamily (Domain)
 [1-138]  2.00000075217456e-14 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [121-202]  1.2e-20 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [120-202]  1.60000240695997e-17 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-16]  0.452 Signal
Eukaryota   
TMHMM No significant hit