close all open/close all

CDS information : Adria_00110


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction3,767 / 4,789 / + [in whole cluster]
1,085 / 2,107 / + [in contig]
Location3767..4789 [in whole cluster]
1085..2107 [in contig]
TypeCDS
Length1,023 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator/repressor
Product (GenBank)putative repressor
Gene
Gene (GenBank)dnrO
EC number
Keyword
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7868594] Regulation of daunorubicin production in Streptomyces peucetius by the dnrR2 locus. (J Bacteriol. , 1995)
[10846224] The dnrO gene encodes a DNA-binding protein that regulates daunorubicin production in Streptomyces peucetius by controlling expression of the dnrN pseudo response regulator gene. (Microbiology. , 2000)
[20122958] The activator/repressor protein DnrO of Streptomyces peucetius binds to DNA without changing its topology. (Int J Biol Macromol. , 2010)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>transcriptional activator/repressor [putative repressor]
MTETPSRMLRLLSLLQNSRDWPGRKLAERLGVSPRTLRRDVERLRDLGYPVQAIPGVGGG
YRLEAGASLPPLLLDDDEAVAIAVGLRTAAGGSVADIEDTSIRALAKLEQVLPKRLRSRV
NALQMYTVPMFTVTPTVSPEHLASVAQACRDQQRLRFTYRKRDGETSSRLVEPYRLVHVN
RKWYVLSWDMGRQDWRTFRVDRMESLLLTGVRFQQRELPAEDAAAYVAQSITSSLAGYRA
LVTLHAPVEVVAERIRPRDGILTAVDHRTCRLRSAADSLEWLALTIGMFGVEFEVHEPPE
LIHYIQELSERLARAASPGADRSVVAPPTRDAPVSGPAAG
selected fasta
>transcriptional activator/repressor [putative repressor]
ATGACCGAGACGCCATCCCGCATGCTCCGTCTGCTGTCCCTCCTCCAGAACAGCCGGGAC
TGGCCAGGGCGCAAGCTGGCGGAGCGGCTCGGGGTCAGCCCGCGGACGCTGCGCCGAGAC
GTGGAACGGTTGCGGGATCTCGGCTACCCGGTTCAGGCCATACCGGGCGTCGGCGGAGGC
TACCGGCTGGAGGCGGGCGCCAGTCTGCCGCCGCTGCTCCTCGACGACGACGAGGCGGTC
GCCATCGCGGTCGGATTACGGACGGCCGCAGGGGGAAGCGTGGCGGACATCGAGGACACC
TCGATCCGCGCGCTGGCCAAGCTGGAGCAGGTGCTGCCCAAGCGGCTGCGCAGCCGGGTC
AACGCCCTTCAGATGTACACCGTCCCCATGTTCACGGTGACCCCGACCGTGAGCCCCGAA
CACCTCGCGTCAGTGGCACAGGCGTGCCGCGACCAGCAGCGGCTGAGATTCACCTACCGC
AAGCGCGACGGGGAGACGAGCAGCCGTCTGGTGGAGCCGTACCGTCTGGTCCATGTGAAC
CGTAAGTGGTACGTGCTGTCCTGGGACATGGGACGGCAGGACTGGCGCACCTTCCGCGTG
GACCGCATGGAATCGCTGCTGTTGACGGGGGTGCGTTTCCAGCAGCGCGAGTTGCCTGCC
GAGGACGCGGCGGCCTATGTGGCGCAGTCGATCACGTCCTCGCTGGCCGGCTACCGGGCG
CTGGTCACCCTGCACGCGCCGGTCGAGGTGGTGGCGGAGCGGATCCGCCCGCGCGACGGA
ATCCTCACAGCGGTCGACCACCGGACATGCCGGCTGCGTTCGGCCGCCGACTCGCTGGAG
TGGCTGGCGCTCACCATCGGGATGTTCGGCGTCGAGTTCGAGGTGCACGAGCCGCCTGAA
CTGATTCATTACATACAGGAGTTGTCGGAGCGGCTGGCCCGAGCCGCGTCGCCGGGCGCG
GACCGCTCCGTGGTGGCGCCGCCGACGCGGGACGCTCCGGTCAGCGGGCCAGCAGCCGGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001034 HTH DeoR N-terminal domain (Domain)
 [4-69]  PS51000
PS51000   HTH_DEOR_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [3-65]  4.10000000000001e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013196 Helix-turn-helix, type 11 (Domain)
 [7-62]  1.5e-14 PF08279
PF08279   HTH_11
IPR018356 Transcription regulator, HTH DeoR-type, conserved site (Conserved_site)
 [7-41]  PS00894
PS00894   HTH_DEOR_1
SignalP
 [1-27]  0.187 Signal
Eukaryota   
TMHMM No significant hit