close all open/close all

CDS information : Adria_00115


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction6,740 / 5,271 / - [in whole cluster]
352 / 1,821 / + [in contig]
Locationcomplement(5271..6740) [in whole cluster]
352..1821 [in contig]
TypeCDS
Length1,470 bp (489 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productaklavinone C-11 hydroxylase
Product (GenBank)aklavinone C-11 hydroxylase
Gene
Gene (GenBank)dnrF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7773378] Streptomyces peucetius daunorubicin biosynthesis gene, dnrF: sequence and heterologous expression. (Microbiology. , 1995)

close this sectionSequence

selected fasta
>aklavinone C-11 hydroxylase [aklavinone C-11 hydroxylase]
MALTKPDVDVLVVGGGLGGLSTALFLARRGARVLLVERHASTSVLPKAAGQNPRTMELFR
FGGVADEILATDDIRGAQGDFTIKVVERVGGRVLHSFAESFEELVGATEQCTPMPWALAP
QDRVEPVLVAHAAKHGAEIRFATELTSFQAGDDGVTARLRDLGTGAESTVSARYLVAADG
PRSAIRESLGITRHGHGTLAHFMGVIFEADLTAVVPPGSTGWYYLQHPDFTGTFGPTDRP
NRHTFYVATTPERGERPEDYTPQRCTELIRLAVDAPGLVPDILDIQAWDMAAYIADRWRE
GPVLLVGDAAKVTPPTGGMGGNTAIGDGFDVAWKLAAVLRGEAGERLLDSYGAERSLVSR
LVVDESLAIYAQRMAPHLLGSVPEERGTAQVVLGFRYRSTAVAAEDDDPEPTEDPRRPSG
RPGFRAPHVWIEQDGTRRSTVELFGDCWVLLAAPEGGAWPGRPPAPPRIWASASTSISSA
AMSPPPPAN
selected fasta
>aklavinone C-11 hydroxylase [aklavinone C-11 hydroxylase]
GTGGCCTTGACGAAGCCGGATGTCGATGTCCTCGTGGTGGGCGGCGGTCTCGGGGGGCTG
TCCACCGCCCTGTTCCTCGCCCGCCGGGGGGCGCGGGTCCTGCTGGTGGAGCGGCATGCC
AGCACCTCGGTCCTGCCCAAGGCGGCAGGCCAGAACCCGCGCACCATGGAACTGTTCCGC
TTCGGCGGCGTGGCCGACGAGATCCTGGCCACGGACGACATCCGCGGCGCCCAGGGCGAC
TTCACCATCAAGGTCGTGGAGCGCGTGGGCGGTCGCGTCCTGCACAGCTTCGCGGAGAGC
TTCGAGGAACTGGTCGGTGCGACGGAACAGTGCACGCCCATGCCCTGGGCGCTCGCTCCC
CAGGACCGGGTGGAGCCCGTCCTGGTGGCCCACGCCGCCAAGCACGGCGCGGAGATCCGG
TTCGCCACCGAACTGACCTCCTTCCAGGCGGGCGACGACGGTGTCACGGCCCGCCTGCGC
GACCTGGGCACGGGAGCGGAGAGCACCGTGAGCGCCCGCTACCTGGTCGCCGCCGACGGA
CCCCGCAGCGCGATCCGGGAGAGCCTGGGCATCACCCGGCACGGTCACGGCACCCTGGCC
CACTTCATGGGCGTCATCTTCGAGGCCGACCTCACCGCCGTCGTACCGCCCGGGTCCACC
GGCTGGTACTACCTGCAGCACCCGGACTTCACCGGCACGTTCGGCCCCACCGACCGGCCC
AACCGGCACACCTTCTACGTCGCTACGACCCCTGAACGCGGCGAGAGGCCGGAGGACTAC
ACACCGCAGCGCTGCACCGAGCTGATCCGGCTGGCTGTCGACGCGCCCGGGCTCGTCCCG
GACATCCTCGACATCCAGGCCTGGGACATGGCGGCGTACATCGCCGACCGGTGGCGCGAA
GGGCCGGTGCTGCTGGTCGGCGATGCCGCCAAGGTCACCCCGCCCACCGGGGGCATGGGC
GGCAACACCGCCATCGGCGACGGGTTCGACGTGGCCTGGAAGCTGGCCGCCGTGCTGCGC
GGCGAGGCGGGCGAGCGGCTCCTCGACAGCTACGGGGCGGAGCGGTCGCTCGTGTCCCGC
CTCGTCGTCGACGAGTCACTCGCCATCTACGCCCAGCGCATGGCTCCCCACCTGCTCGGC
AGCGTTCCCGAGGAACGCGGTACGGCGCAGGTCGTCCTGGGCTTCCGCTACCGCTCCACC
GCCGTCGCCGCCGAGGACGACGACCCCGAGCCGACCGAGGATCCGCGACGCCCGTCCGGG
CGCCCCGGCTTCCGCGCACCCCACGTCTGGATCGAACAGGACGGCACACGGCGTTCCACC
GTCGAGTTGTTCGGCGACTGCTGGGTGCTCCTGGCCGCACCGGAGGGCGGCGCCTGGCCC
GGGCGGCCGCCCGCGCCGCCGCGGATCTGGGCGTCCGCCTCGACGTCCATCTCGTCGGCC
GCGATGTCGCCGCCCCCTCCGGCGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [7-365]  3.10000000000005e-108 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [9-31]  2.80000504261099e-38 PR00420 [171-186]  2.80000504261099e-38 PR00420 [300-315]  2.80000504261099e-38 PR00420 [315-331]  2.80000504261099e-38 PR00420 [333-351]  2.80000504261099e-38 PR00420 [351-367]  2.80000504261099e-38 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit