close all open/close all

CDS information : Adria_00130


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction7,562 / 8,554 / + [in whole cluster]
471 / 1,463 / + [in contig]
Location7562..8554 [in whole cluster]
471..1463 [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productmultidrug resistance ABC transporter ATP-binding protein
Product (GenBank)daunorubicin resistance protein
Gene
Gene (GenBank)drrA
EC number
Keyword
Note
Note (GenBank)
  • protein has ATP binding site
Reference
ACC
PmId
[1924314] A bacterial analog of the mdr gene of mammalian tumor cells is present in Streptomyces peucetius, the producer of daunorubicin and doxorubicin. (Proc Natl Acad Sci U S A. , 1991)
[9006006] Expression and characterization of DrrA and DrrB proteins of Streptomyces peucetius in Escherichia coli: DrrA is an ATP binding protein. (J Bacteriol. , 1997)
[15709779] Biochemical characterization of domains in the membrane subunit DrrB that interact with the ABC subunit DrrA: identification of a conserved motif. (Biochemistry. , 2005)
[19063901] Translational coupling controls expression and function of the DrrAB drug efflux pump. (J Mol Biol. , 2009)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)
[24634217] The DrrAB efflux system of Streptomyces peucetius is a multidrug transporter of broad substrate specificity. (J Biol Chem. , 2014)
[25721665] Characterization of a novel domain 'GATE' in the ABC protein DrrA and its role in drug efflux by the DrrAB complex. (Biochem Biophys Res Commun. , 2015)

close this sectionSequence

selected fasta
>multidrug resistance ABC transporter ATP-binding protein [daunorubicin resistance protein]
MNTQPTRAIETSGLVKVYNGTRAVDGLDLNVPAGLVYGILGPNGAGKSTTIRMLATLLRP
DGGTARVFGHDVTSEPDTVRRRISVTGQYASVDEGLTGTENLVMMGRLQGYSWARARERA
AELIDGFGLGDARDRLLKTYSGGMRRRLDIAASIVVTPDLLFLDEPTTGLDPRSRNQVWD
IVRALVDAGTTVLLTTQYLDEADQLADRIAVIDHGRVIAEGTTGELKSSLGSNVLRLRLH
DAQSRAEAERLLSAELGVTIHRDSDPTALSARIDDPRQGMRALAELSRTHLEVRSFSLGQ
SSLDEVFLALTGHPADDRSTEEAAEEEKVA
selected fasta
>multidrug resistance ABC transporter ATP-binding protein [daunorubicin resistance protein]
GTGAACACGCAGCCGACACGGGCCATCGAAACGTCCGGTCTCGTCAAGGTCTACAACGGG
ACGAGGGCGGTGGACGGCCTGGACCTCAACGTCCCGGCCGGTCTCGTCTACGGGATCCTG
GGGCCGAACGGCGCCGGCAAGTCCACCACCATCCGCATGCTGGCGACGCTGCTGCGTCCC
GACGGCGGTACGGCCCGGGTCTTCGGTCACGACGTGACGAGCGAACCCGATACGGTCCGC
CGCAGGATCAGTGTCACCGGCCAGTACGCCTCCGTCGACGAGGGCCTGACCGGTACGGAG
AACCTCGTCATGATGGGCCGGCTCCAGGGCTACTCCTGGGCCCGGGCCAGGGAGCGCGCC
GCCGAACTGATCGACGGCTTCGGACTGGGCGACGCCCGCGACCGGCTCCTGAAGACCTAC
TCCGGTGGCATGCGGCGGCGGCTCGACATCGCCGCGAGCATCGTCGTCACCCCCGACCTG
CTGTTCCTGGACGAACCGACCACCGGTCTCGACCCGCGCAGCCGGAACCAGGTCTGGGAC
ATCGTGCGGGCTCTGGTGGACGCCGGCACGACGGTGCTGCTGACGACGCAGTACCTCGAC
GAGGCGGACCAACTGGCCGACCGCATCGCGGTCATCGACCACGGCCGGGTGATCGCGGAG
GGCACCACCGGGGAGCTGAAGTCCTCGCTCGGGTCCAACGTCCTGCGGCTGCGCCTCCAC
GACGCCCAGTCGCGTGCCGAGGCGGAACGGCTGCTGAGCGCGGAACTGGGCGTCACGATC
CACCGCGACTCCGATCCGACGGCGCTGAGCGCGCGGATCGACGACCCCCGGCAGGGCATG
CGGGCCCTGGCCGAGCTGTCGCGCACGCACTTGGAGGTACGCAGTTTCTCCCTCGGCCAG
TCCAGTCTCGACGAGGTCTTCCTGGCGCTGACCGGCCACCCGGCCGATGACCGGTCCACG
GAAGAAGCGGCGGAAGAGGAGAAGGTGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [9-239]  PS50893
PS50893   ABC_TRANSPORTER_2
 [48-168]  2.80000000000001e-18 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [33-216]  7.70000171387738e-16 SM00382
SM00382   AAA
IPR005894 Daunorubicin resistance ABC transporter ATP-binding subunit (Family)
 [16-312]  8.80000000000003e-123 TIGR01188
TIGR01188   DrrA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [140-154]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-23]  0.068 Signal
Eukaryota   
TMHMM No significant hit