close all open/close all

CDS information : Adria_00140


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction8,551 / 9,402 / + [in whole cluster]
1,460 / 2,311 / + [in contig]
Location8551..9402 [in whole cluster]
1460..2311 [in contig]
TypeCDS
Length852 bp (283 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productmultidrug resistance ABC transporter permease protein
Product (GenBank)daunorubicin resistance protein
Gene
Gene (GenBank)drrB
EC number
Keyword
Note
Note (GenBank)
  • hydrophobic protein
Reference
ACC
PmId
[1924314] A bacterial analog of the mdr gene of mammalian tumor cells is present in Streptomyces peucetius, the producer of daunorubicin and doxorubicin. (Proc Natl Acad Sci U S A. , 1991)
[9006006] Expression and characterization of DrrA and DrrB proteins of Streptomyces peucetius in Escherichia coli: DrrA is an ATP binding protein. (J Bacteriol. , 1997)
[15709779] Biochemical characterization of domains in the membrane subunit DrrB that interact with the ABC subunit DrrA: identification of a conserved motif. (Biochemistry. , 2005)
[19063901] Translational coupling controls expression and function of the DrrAB drug efflux pump. (J Mol Biol. , 2009)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)
[24634217] The DrrAB efflux system of Streptomyces peucetius is a multidrug transporter of broad substrate specificity. (J Biol Chem. , 2014)

close this sectionSequence

selected fasta
>multidrug resistance ABC transporter permease protein [daunorubicin resistance protein]
MTTSPGTVESTTPVSGQLRTVLSAGERPARATAVSATLTHLWRAMMAFKHFPVQLIDIVL
MPLIFLLMFTYLFGGAFADSTEEYLQFYLPGVTVQAVVMMTVYTGTSLNTDIHKGVFDRF
RTLPFWQPATLAGSLLGDVLRYVVALATTVSLGLLLGFRADGGFLGVVGAMLVLIVFGFS
VSWIFAALGVVASEPERVSGTSMIVLYPLLFMSNIFVMPETMPGWMQAIVDANPMSHAAT
ASRELMHGTAGFWDVGLVLCVSAGLVAVFAPLTMRLYRNKNAH
selected fasta
>multidrug resistance ABC transporter permease protein [daunorubicin resistance protein]
ATGACGACGTCCCCCGGCACCGTGGAATCCACGACCCCTGTGAGCGGTCAGCTGCGGACG
GTGCTGTCCGCGGGTGAACGGCCGGCCCGCGCGACGGCGGTGTCCGCCACCCTGACCCAT
CTGTGGCGGGCGATGATGGCGTTCAAGCACTTCCCGGTGCAGCTGATCGACATCGTCCTG
ATGCCGTTGATCTTCCTGCTGATGTTCACGTACCTGTTCGGCGGGGCGTTCGCGGACTCC
ACCGAGGAGTACCTGCAGTTCTACCTCCCGGGCGTGACGGTGCAGGCGGTCGTCATGATG
ACGGTCTACACCGGCACCTCGCTCAACACGGACATCCACAAGGGCGTATTCGACCGTTTC
CGGACGCTCCCCTTCTGGCAGCCGGCGACGCTCGCGGGCAGTCTCCTCGGTGACGTGCTC
CGGTACGTCGTCGCCCTGGCGACCACGGTGTCCCTCGGGCTGCTGCTGGGCTTCCGCGCC
GACGGCGGTTTCCTCGGCGTGGTCGGCGCGATGCTGGTGCTGATCGTCTTCGGGTTCAGC
GTGAGCTGGATCTTCGCCGCCCTGGGCGTGGTGGCCAGCGAGCCCGAACGGGTCTCCGGG
ACCAGCATGATCGTGCTGTATCCGCTGCTGTTCATGAGCAACATCTTCGTCATGCCGGAG
ACGATGCCCGGCTGGATGCAGGCCATCGTCGACGCCAACCCGATGAGCCACGCGGCGACG
GCCTCCCGCGAGCTCATGCACGGCACGGCCGGCTTCTGGGACGTGGGCCTGGTCCTGTGC
GTGTCGGCAGGGCTGGTGGCCGTCTTCGCACCGCTGACCATGCGTCTGTACCGCAACAAG
AACGCCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [53-280]  PS51012
PS51012   ABC_TM2
IPR013525 ABC-2 type transporter (Domain)
 [39-246]  3.5e-26 PF01061
PF01061   ABC2_membrane
SignalP
 [1-33]  0.304 Signal
Bacteria, Gram-positive   
TMHMM
 [55-77]  Transmembrane (o-i) [84-106]  Transmembrane (i-o) [139-158]  Transmembrane (o-i) [165-187]  Transmembrane (i-o) [250-272]  Transmembrane (o-i)
Transmembrane 5