close all open/close all

CDS information : Adria_00150


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction9,454 / 9,814 / + [in whole cluster]
2,363 / 2,723 / + [in contig]
Location9454..9814 [in whole cluster]
2363..2723 [in contig]
TypeCDS
Length361 bp (119 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • located downstream of drrB gene
Reference
ACC
PmId
[1924314] A bacterial analog of the mdr gene of mammalian tumor cells is present in Streptomyces peucetius, the producer of daunorubicin and doxorubicin. (Proc Natl Acad Sci U S A. , 1991)

close this sectionSequence

selected fasta
>hypothetical protein(fragment)
MSGAPTVPGDTSRRFHRHLEGASPVARYPQAPSAPHAQVRPSSVVGRHDPRYPDLVGRGI
NARFTPDPDTVRVVATAEQAVRAVQDSVRDGTRLAVRSGGHCFESLVDDPAVTTVIDVSE
-
selected fasta
>hypothetical protein(fragment)
GTGAGCGGCGCACCTACTGTCCCCGGAGACACATCCCGGAGATTTCACAGACACCTGGAA
GGGGCGTCTCCCGTGGCCCGGTACCCACAGGCTCCCTCGGCACCGCACGCACAGGTCCGG
CCGTCCTCCGTCGTCGGCCGGCACGATCCCCGTTACCCCGATCTGGTCGGCCGCGGCATC
AACGCCCGCTTCACCCCCGACCCCGACACCGTCCGGGTGGTGGCCACCGCGGAGCAGGCC
GTGCGGGCGGTGCAGGACAGCGTGCGCGACGGTACCCGGCTGGCGGTGCGCAGCGGGGGG
CACTGCTTCGAGTCGCTCGTGGACGACCCCGCCGTCACCACGGTGATCGACGTGTCCGAG
A

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit