close all open/close all

CDS information : Adria_00160


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction11,897 / 11,079 / - [in whole cluster]
139 / 957 / + [in contig]
Locationcomplement(11079..11897) [in whole cluster]
139..957 [in contig]
TypeCDS
Length819 bp (272 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)polyketide cyclase
Gene
Gene (GenBank)dpsY
EC number
Keyword
  • 2nd and 3rd ring
Note
Note (GenBank)
  • DpsY; component of daunorubicin/doxorubicin polyketide synthase
Reference
ACC
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
[11520231] Production of aromatic minimal polyketides by the daunorubicin polyketide synthase genes reveals the incompatibility of the heterologous DpsY and JadI cyclases. (J Nat Prod. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)

close this sectionSequence

selected fasta
>cyclase [polyketide cyclase]
MCCGGPRGAEATTMRIIDISSAVDASGWEPDEVRHEVHSPREGAVHMSEEMRRHFGVAFD
PDELPEGEFLSLDRLTLTSHTGTHIDAPSHYGSRAHYGDGRPRNIDELPLDWFYGPGLLL
DLTGCDGPTAGAGDLEKELARIGRVPEPGTIVLLRTGASERAGTEQYFTDFTGLDGPAVN
LLLDHGVRVIGTDAFSLDAPFGAVIRRYRETGDRSVLWPAHVTGRHREYCQIERLGNLAA
LPGCDGFQVACFPVKITGGGAGWTRAVAFVDE
selected fasta
>cyclase [polyketide cyclase]
GTGTGCTGTGGTGGCCCGAGAGGAGCGGAGGCGACGACCATGCGGATCATCGACATCTCC
AGCGCGGTGGACGCGTCGGGATGGGAACCGGACGAAGTGCGGCACGAGGTGCACAGCCCC
CGGGAGGGCGCCGTCCACATGAGCGAGGAGATGCGGCGTCACTTCGGTGTCGCGTTCGAC
CCCGACGAGCTGCCCGAAGGCGAGTTCCTGTCGCTCGACCGTCTCACGCTCACGTCCCAC
ACCGGCACGCACATCGACGCTCCCTCCCACTACGGCTCACGGGCGCACTACGGCGACGGC
AGGCCGCGGAACATCGACGAGCTGCCACTCGACTGGTTCTACGGCCCGGGGCTGCTGCTC
GACCTCACCGGCTGCGATGGACCGACGGCCGGGGCCGGGGACCTGGAGAAGGAACTGGCC
CGCATCGGCCGGGTGCCGGAACCGGGCACCATCGTCCTGCTCCGCACCGGCGCCTCCGAG
CGGGCCGGGACCGAGCAGTACTTCACCGACTTCACCGGTCTGGACGGCCCCGCCGTCAAC
CTGCTGCTCGACCACGGCGTGCGGGTCATCGGCACCGACGCGTTCAGCCTGGACGCGCCG
TTCGGCGCCGTCATCCGCCGGTACCGGGAGACGGGTGACCGGTCGGTGCTCTGGCCGGCG
CATGTCACCGGCCGCCACAGGGAGTACTGCCAGATCGAGCGGCTGGGGAACCTGGCCGCG
CTGCCGGGGTGCGACGGCTTCCAGGTCGCCTGCTTCCCCGTGAAGATCACCGGCGGGGGG
GCCGGCTGGACCCGCGCGGTCGCCTTCGTCGACGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [17-200]  4.80000000000003e-37 PF04199
PF04199   Cyclase
SignalP
 [1-25]  0.074 Signal
Bacteria, Gram-negative   
TMHMM No significant hit