close all open/close all

CDS information : Adria_00170


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction11,026 / 9,815 / - [in whole cluster]
1,010 / 2,221 / + [in contig]
Locationcomplement(9815..11026) [in whole cluster]
1010..2221 [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative NDP-hexose C-3 C-methyltransferase
Product (GenBank)daunorubicin/doxorubicin biosynthesis enzyme
Gene
Gene (GenBank)dnrX
EC number2.1.1.-
Keyword
  • baumycin
Note
Note (GenBank)
  • DnrX
Reference
ACC
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
[23885759] Nitrososynthase-triggered oxidative carbon-carbon bond cleavage in baumycin biosynthesis. (J Am Chem Soc. , 2013)
Related Reference
ACC
P96561
NITE
Chlor_00150
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 C-methyltransferase [daunorubicin/doxorubicin biosynthesis enzyme]
MEPNESTCRICGGRVREFFDFGRQPLSDYFPSEEELDNEFFFRLAVGMCVTCTMVQLLEE
VPRDRMFRYDYPYHSSGSERMREHFAATARRLIGTELTGRDPFCVEIGSNDGVMLRTVRD
AGVRHLGVEPSGGVADVSRAEGIQVRTAFFEESTAREIAQEHGPANVIYAANTICHIPYL
DSVFRGIDALLAPDGVFVFEDPYLGDIVEKNTFDQIYDEHFYLFTARSVSTTAQHFGFEL
VDVERLPVHGGEVRYTIARAGRRQPSPRVGELIAEESRRGLADLTTLEKFGAQVKRVCCD
LVARLRELRDLGFYVVGYGATAKSATVLNYAGIGPDLLPCVYDTTPAKIGRRLPGSHIPI
RSAEEFRAPYPDYALLFAWNHLDEVQAREAEFTKQGGRWIRSG
selected fasta
>putative NDP-hexose C-3 C-methyltransferase [daunorubicin/doxorubicin biosynthesis enzyme]
ATGGAGCCGAACGAATCGACATGTCGTATCTGCGGTGGCCGAGTACGGGAGTTCTTCGAC
TTCGGCCGCCAGCCGCTGTCCGACTACTTCCCGTCGGAGGAGGAGCTCGACAACGAGTTC
TTCTTCCGGCTCGCGGTCGGGATGTGCGTCACGTGCACCATGGTCCAGCTGCTGGAGGAG
GTGCCCAGGGACCGCATGTTCCGCTACGACTACCCGTACCACTCGTCGGGGTCGGAGCGG
ATGCGCGAGCACTTCGCGGCGACCGCCCGCCGGCTGATCGGCACCGAGCTGACCGGGCGG
GACCCGTTCTGCGTGGAGATCGGCAGCAACGACGGAGTGATGCTCCGCACGGTGCGCGAC
GCCGGTGTCCGACACCTGGGCGTGGAGCCTTCCGGCGGTGTCGCCGACGTGTCCCGGGCC
GAGGGCATCCAGGTGCGGACCGCGTTCTTCGAGGAGTCCACGGCCCGGGAGATCGCCCAG
GAACACGGGCCCGCGAACGTCATCTACGCGGCCAACACGATCTGTCATATCCCGTACCTC
GACTCCGTCTTCCGCGGTATCGACGCCCTCCTCGCGCCGGACGGCGTCTTCGTCTTCGAG
GACCCCTACCTCGGCGACATCGTCGAGAAGAACACCTTCGACCAGATCTACGACGAGCAC
TTCTACCTGTTCACCGCCCGCTCGGTGAGCACCACCGCCCAGCACTTCGGATTCGAACTG
GTCGACGTGGAGCGGCTCCCGGTGCACGGCGGCGAGGTCCGCTACACCATCGCCCGCGCG
GGCCGGCGGCAGCCGAGCCCCCGGGTCGGCGAGCTCATCGCCGAGGAGAGCCGGCGCGGG
CTCGCCGACCTGACGACGCTGGAGAAGTTCGGCGCCCAGGTCAAGCGGGTCTGCTGTGAC
CTGGTGGCCCGTCTGCGCGAGCTGCGCGACCTCGGCTTCTACGTCGTCGGGTACGGGGCG
ACCGCCAAGAGCGCCACAGTGCTCAACTATGCGGGGATCGGCCCCGATCTGCTGCCGTGC
GTCTACGACACCACGCCGGCCAAGATCGGCCGTCGGCTCCCCGGGTCCCACATCCCCATC
CGCTCCGCCGAGGAGTTCCGGGCCCCCTACCCCGACTATGCGCTGCTCTTCGCCTGGAAC
CACCTAGACGAAGTCCAGGCCCGAGAGGCGGAGTTCACGAAGCAGGGGGGCCGCTGGATC
CGCTCAGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [8-68]  7.7e-20 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [246-400]  6.29999999999997e-47 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit