close all open/close all

CDS information : Adria_00180


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction12,060 / 13,088 / + [in whole cluster]
25 / 1,053 / + [in contig]
Location12060..13088 [in whole cluster]
25..1053 [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
ProductdTDP-L-epivancosamine nitrososynthase
FAD-dependent oxidoreductase
Product (GenBank)putative flavoprotein
Gene
Gene (GenBank)dnmZ
EC number
Keyword
  • baumycin
Note
Note (GenBank)
  • DnmZ
Reference
ACC
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[23885759] Nitrososynthase-triggered oxidative carbon-carbon bond cleavage in baumycin biosynthesis. (J Am Chem Soc. , 2013)
[26457508] Structure of DnmZ, a nitrososynthase in the Streptomyces peucetius anthracycline biosynthetic pathway. (Acta Crystallogr F Struct Biol Commun. , 2015)
Related Reference
ACC
A0A0R4I990
PmId
[26457508] Structure of DnmZ, a nitrososynthase in the Streptomyces peucetius anthracycline biosynthetic pathway. (Acta Crystallogr F Struct Biol Commun. , 2015)

close this sectionSequence

selected fasta
>dTDP-L-epivancosamine nitrososynthase [putative flavoprotein]
MTKPSVHEHPGVLADNGLCRPKTPAGRRLLDLLERYLPALEAESRDNDREATLPVHLFDR
MRKEGVLGATVPEDLGGLGVHSLHDVALALARIAGRDAGVALALHMQFSRGLTLDFEWRH
GAPSTRLEEAGAPVRLAAPVVARTTPGLTVLDNWDGMGMRSSGSVDIVFDGCP-DRDRVL
PRRRAGRRDDAALAGQTSARTHAGYHSATPRRSRIALTELRRRGGAPAGVRTTVAEIDAR
LFALHTAVASALTTADRLADDLSGDLAARGRAMMTPFQYAKLLVNRHSVGVVDDCLMLVG
GAGYSNSHPLARLYRDVRAGGFMHPYNFTDGVDYLSEVALGR
selected fasta
>dTDP-L-epivancosamine nitrososynthase [putative flavoprotein]
ATGACAAAGCCATCTGTGCACGAACACCCCGGTGTCCTGGCCGACAACGGCCTCTGCAGA
CCCAAGACGCCGGCCGGGCGACGGCTGCTCGACCTTCTGGAGCGGTACCTGCCGGCCCTG
GAGGCGGAGAGCCGGGACAACGACCGCGAGGCCACTCTGCCCGTCCACCTCTTCGACCGG
ATGCGCAAGGAGGGCGTGCTGGGGGCCACCGTCCCGGAGGACCTCGGAGGGCTCGGCGTC
CACTCGTTGCACGACGTCGCGCTGGCCCTGGCCAGGATCGCCGGCCGGGACGCGGGCGTG
GCGCTGGCTCTGCACATGCAGTTCAGCCGGGGTCTGACCCTGGACTTCGAGTGGCGGCAC
GGGGCACCGTCGACCCGGCTGGAGGAGGCGGGCGCCCCCGTCCGGCTGGCCGCACCGGTG
GTCGCGCGCACCACACCGGGCCTGACCGTACTGGACAACTGGGACGGAATGGGCATGCGG
TCGTCGGGCAGTGTGGACATCGTCTTCGACGGCTGTCCGNTGGACCGGGACCGGGTGCTG
CCGCGACGGCGAGCCGGGCGTCGCGACGACGCGGCGCTCGCCGGGCAGACGTCAGCTCGT
ACGCATGCTGGCTATCACTCGGCTACGCCGAGGCGCTCGAGGATCGCCCTCACGGAACTG
CGCAGGCGCGGCGGGGCGCCGGCCGGGGTGCGGACCACGGTGGCCGAGATAGACGCCCGG
CTGTTCGCGCTGCACACGGCGGTGGCGAGCGCGTTGACCACCGCCGACCGGCTCGCCGAC
GACCTCAGCGGCGACCTCGCCGCCCGCGGCCGCGCCATGATGACGCCCTTCCAGTACGCC
AAGCTGCTCGTCAACCGGCACTCGGTGGGCGTGGTGGACGACTGCCTGATGCTCGTGGGA
GGGGCCGGATACAGCAACTCCCACCCGCTGGCGCGCCTGTACCGCGATGTCCGGGCGGGC
GGGTTCATGCATCCATACAACTTCACGGACGGCGTCGACTACCTGAGCGAAGTGGCGTTG
GGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [225-321]  1.2e-09 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [131-180]  4.3e-09 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [40-122]  3.1e-09 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [221-325]  1.80000149287196e-10 SSF47203
SSF47203   AcylCoADH_C_like
 [201-328]  3.2e-14 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [23-184]  9.5000102816722e-18 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [23-110]  4.6e-13 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit