close all open/close all

CDS information : Adria_00190


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction13,135 / 13,761 / + [in whole cluster]
1,100 / 1,726 / + [in contig]
Location13135..13761 [in whole cluster]
1100..1726 [in contig]
TypeCDS
Length627 bp (208 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose epimerase
Product (GenBank)putative epimerase
Gene
Gene (GenBank)dnmU
EC number5.1.3.-
Keyword
  • daunosamine
Note
Note (GenBank)
  • DnmU
Reference
ACC
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[11129052] Analysis of genes involved in 6-deoxyhexose biosynthesis and transfer in Saccharopolyspora erythraea. (Mol Gen Genet. , 2000)
Related Reference
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)
ACC
C5J048
PmId
[22893224] Exploration of two epimerase homologs in Streptomyces peucetius ATCC 27952. (Appl Microbiol Biotechnol. , 2012)

close this sectionSequence

selected fasta
>NDP-hexose epimerase [putative epimerase]
MKARELAVQGAYTFEPEVFPDERGLFVSPFREDAFTAAVGHPLFPVRQTNHSRSRRGVVR
GVHYTVTPPGSAKYVYCARGRSLDIVVDVRVGSPTYGRWDAVELEPREFRAVYFPVGVGH
AFVALEDDTVMSYMLSGEYVQANELAVSVLDPALGLPVPGDLEPLLSGRDRAAPPLEQAR
AAGTLPEYAACRAVESELWPPAGSRGDG
selected fasta
>NDP-hexose epimerase [putative epimerase]
ATGAAGGCGCGGGAACTGGCGGTGCAGGGGGCGTACACGTTCGAGCCGGAGGTGTTTCCG
GACGAGCGGGGGCTGTTCGTCTCACCGTTCCGGGAGGATGCGTTCACGGCCGCGGTCGGC
CACCCCCTCTTCCCGGTGCGGCAGACGAATCACAGCCGGTCGCGGCGCGGGGTGGTGCGG
GGCGTGCACTACACCGTGACGCCGCCGGGCTCGGCCAAGTACGTGTACTGCGCCCGTGGC
AGGTCGCTGGACATCGTCGTCGACGTGCGGGTCGGCTCCCCGACGTACGGCCGGTGGGAC
GCCGTCGAGCTGGAGCCGCGTGAGTTCCGGGCGGTGTACTTCCCGGTCGGGGTGGGGCAC
GCCTTCGTGGCCCTGGAGGACGACACCGTCATGTCGTACATGCTGTCCGGGGAGTACGTG
CAGGCCAACGAACTCGCCGTGTCGGTGCTGGACCCGGCCCTCGGGCTGCCCGTGCCGGGT
GACCTGGAGCCTCTGCTGTCCGGCCGGGACCGGGCTGCACCGCCCCTGGAGCAGGCCCGG
GCCGCCGGGACCCTTCCGGAGTACGCCGCATGCCGGGCGGTCGAGTCGGAGCTGTGGCCG
CCGGCCGGGTCACGCGGAGACGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-183]  PD001462
PD001462   dTDP_sugar_isom
 [4-178]  7.20000000000003e-60 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-183]  2.7000136937899e-65 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-191]  5.49999999999995e-59 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit