close all open/close all

CDS information : Adria_00200


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction13,769 / 14,692 / + [in whole cluster]
1,734 / 2,657 / + [in contig]
Location13769..14692 [in whole cluster]
1734..2657 [in contig]
TypeCDS
Length924 bp (307 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-4 ketoreductase
Product (GenBank)thymidine diphospho-4-keto-2,3,6-trideoxyhexulose reductase
Gene
Gene (GenBank)dnmV
EC number
Keyword
  • daunosamine
Note
Note (GenBank)
  • DnmV
Reference
ACC
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>NDP-hexose C-4 ketoreductase [thymidine diphospho-4-keto-2,3,6-trideoxyhexulose reductase]
MRVVVLGATGSVGRQVCAAYQAHGWDVHGVARRPAPHLSGCGFTELDLAAAAPGRIATVL
GDLPADVVVNAAGGWGDTEEEMTYSHLRLVRRLVEALALLPFRPRLVHLGSVHEYGPVPA
GTLLHEDLLPEPVTPYARVKLETSSAVLTAARAGVLDAVVLRAANMSGPHPPQESFLAAL
MARISTAFAHGGRLELSVADARRDFIDVRDVAQAVVRAGRAPAVGGLVVNIGRGDAVPIG
DLVGWLLEAAAFPEDRVDRREAPVRSKGGDWTRLDIGRARRLLSWAPRIGLRDSVHSMWR
TAHGAPA
selected fasta
>NDP-hexose C-4 ketoreductase [thymidine diphospho-4-keto-2,3,6-trideoxyhexulose reductase]
ATGCGGGTCGTGGTTCTGGGGGCGACGGGCAGCGTCGGTCGGCAGGTGTGTGCGGCGTAC
CAGGCGCACGGGTGGGACGTGCACGGGGTGGCCCGCCGCCCGGCGCCGCACCTGAGCGGG
TGCGGGTTCACGGAGCTGGACCTCGCGGCCGCCGCGCCTGGGCGGATCGCCACGGTGCTG
GGTGATCTTCCGGCGGACGTCGTGGTCAACGCGGCGGGCGGCTGGGGCGACACCGAGGAG
GAGATGACGTACTCGCATCTGCGACTGGTGCGACGCCTGGTGGAGGCGCTCGCGCTGCTC
CCGTTCCGGCCCCGGCTGGTCCATCTGGGGTCGGTGCACGAGTACGGTCCCGTGCCGGCC
GGCACGCTGCTGCACGAGGACCTGCTGCCGGAGCCGGTCACGCCGTACGCGCGCGTCAAA
CTGGAGACCTCGTCGGCCGTCCTGACCGCAGCGCGGGCCGGTGTCCTGGACGCGGTGGTG
CTGCGCGCGGCGAACATGTCGGGCCCGCATCCGCCGCAGGAGAGTTTCCTGGCCGCCCTG
ATGGCGCGTATCAGCACGGCATTCGCGCACGGTGGGCGGCTGGAGTTGAGCGTCGCGGAC
GCACGGCGGGACTTCATCGACGTGCGGGACGTCGCACAGGCGGTGGTGCGTGCCGGGCGG
GCTCCGGCGGTCGGCGGGCTGGTCGTCAACATCGGGCGCGGGGACGCCGTGCCGATCGGT
GATCTGGTCGGCTGGCTGCTGGAGGCCGCCGCCTTCCCGGAGGACCGGGTCGACCGCCGG
GAGGCGCCGGTGCGGAGCAAGGGCGGCGACTGGACCCGGCTGGACATCGGGCGGGCCCGG
CGGTTGCTGTCCTGGGCGCCGCGCATCGGCCTGCGGGACTCCGTCCACAGCATGTGGCGG
ACCGCGCACGGCGCCCCGGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-232]  2.59999999999998e-38 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [1-206]  1.3e-26 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-18]  0.826 Signal
Eukaryota   
TMHMM No significant hit