close all open/close all

CDS information : Adria_00210


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction16,804 / 15,986 / - [in whole cluster]
202 / 1,020 / + [in contig]
Locationcomplement(15986..16804) [in whole cluster]
202..1020 [in contig]
TypeCDS
Length819 bp (272 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)
Gene
Gene (GenBank)dnrI
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[1729206] Regulation of secondary metabolism in Streptomyces spp. and overproduction of daunorubicin in Streptomyces peucetius. (J Bacteriol. , 1992)
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[8971703] Purification and characterization of the DNA-binding protein DnrI, a transcriptional factor of daunorubicin biosynthesis in Streptomyces peucetius. (Mol Microbiol. , 1996)
[16545946] Feedback regulation of doxorubicin biosynthesis in Streptomyces peucetius. (Res Microbiol. , 2006)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>transcriptional activator
MQINMLGPLVAHHNGTSVTPIARKPRQVFSLLALQAGTVVPVPALMDELWGTQPPASALT
TLQTYILQVRRGITVALGASHNGPAKDVLRTCYGGYLLDVDPTNTDVYAFERLAEEGKRA
CERGELDLASARFRQALDLWRGDALVDVHAGMRIGMEVARLEESRLGVLEARMETDLRLG
RHAGLLPELSALTARHPMHENLWAQFMIALHRSGRTSQALEAFIKLRKTLVNELGVEPSA
RLQHLQHAILRADPGIDRNGPEVPAAASVALA
selected fasta
>transcriptional activator
ATGCAGATCAATATGTTGGGCCCGCTCGTCGCACATCACAATGGCACGTCGGTGACCCCG
ATAGCCAGAAAGCCCCGGCAAGTATTCTCACTGCTCGCTCTCCAGGCAGGAACCGTCGTG
CCGGTGCCCGCGCTGATGGACGAGCTCTGGGGAACCCAACCCCCGGCGAGCGCGCTGACC
ACCCTTCAGACCTACATCCTTCAAGTGCGCCGGGGCATCACCGTGGCCCTCGGCGCGAGC
CACAACGGACCCGCCAAGGACGTGCTGCGCACCTGCTACGGCGGCTACCTGCTCGACGTG
GACCCCACCAACACCGACGTGTACGCCTTCGAGCGTCTCGCCGAGGAGGGCAAGCGGGCG
TGCGAGCGGGGAGAGCTCGACCTGGCCTCCGCACGCTTCCGCCAGGCCCTCGACCTGTGG
CGCGGAGACGCGCTCGTGGACGTGCACGCCGGCATGCGGATCGGCATGGAGGTGGCGCGC
CTGGAGGAGAGCCGGCTCGGCGTCCTGGAGGCCCGCATGGAGACCGACCTGAGGCTGGGC
CGGCACGCGGGCCTGCTGCCCGAGCTGTCGGCGCTCACCGCCCGCCACCCCATGCACGAG
AACCTGTGGGCCCAATTCATGATCGCCCTCCATCGCTCGGGCCGCACGAGCCAGGCCCTC
GAAGCCTTCATCAAACTCCGCAAGACATTGGTGAACGAGCTGGGGGTGGAACCGTCCGCC
CGTCTCCAGCACCTCCAGCACGCGATTCTGCGGGCCGACCCCGGCATCGACCGGAACGGT
CCGGAAGTCCCGGCAGCCGCGTCCGTCGCGCTTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-98]  9.80000272130218e-09 SM00862
SM00862   Trans_reg_C
 [19-98]  1.9e-15 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [105-250]  2.4e-51 PF03704
PF03704   BTAD
 [105-250]  1e-49 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [111-228]  4e-05 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [19-101]  1.8e-06 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-99]  6.49999377884395e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-13]  0.246 Signal
Bacteria, Gram-negative   
TMHMM No significant hit