close all open/close all

CDS information : Adria_00220


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction15,963 / 14,851 / - [in whole cluster]
1,043 / 2,155 / + [in contig]
Locationcomplement(14851..15963) [in whole cluster]
1043..2155 [in contig]
TypeCDS
Length1,113 bp (370 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 aminotransferase
Product (GenBank)
GenednmJ
Gene (GenBank)dnrJ
EC number2.6.1.-
Keyword
  • daunosamine
Note
Note (GenBank)
Reference
ACC
PmId
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
Related Reference
ACC
Q9F837
NITE
Megalo_00050
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)
ACC
Q2PC67
NITE
Rubra_00230
PmId
[16614891] Functional characterization of ketoreductase (rubN6) and aminotransferase (rubN4) genes in the gene cluster of Streptomyces achromogenes var. rubradiris. (Biotechnol Lett. , 2006)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 aminotransferase
MSTYVWQYLNEYREERADILDAVETVFESGQLILGTSVRSFEEEFAAYHGLPYCTGVDNG
TNALVLGLRALGIGPGDEVVTVSNTAAPTVVAIDAVGATPVFVDVHEENYLMDTGRLRSV
IGPRTRCLLPVHLYGQSVDMTPVLELAAEHDLKVLEDCAQAHGARRHGRLVGTQGHAAAF
SFYPTKVLGAYGDGGAVVTPDAEVDRRLRRLRYYGMGERYYVVDTPGHNSRLDEVQAEIL
RRKLRRLDAYVEGRRAVARRYEEGLGDLDGLVLPTIAEGNDHVYYVYVVRHPERDRILEA
LTAYDIHLNISYPWPVHTMSGFAHLGYGPGDLPVTERLAGEIFSLPMYPSLRPDAQEKVI
DAVREVVGSL
selected fasta
>putative NDP-hexose C-3 aminotransferase
GTGTCCACCTACGTCTGGCAATACCTCAATGAATACCGGGAAGAACGCGCCGACATTCTC
GATGCGGTGGAAACCGTATTCGAGTCCGGCCAGCTTATTCTCGGGACCAGCGTCCGCTCT
TTCGAGGAGGAGTTCGCCGCTTATCACGGACTGCCGTACTGCACGGGCGTCGACAACGGC
ACCAACGCGCTGGTCCTCGGCCTGCGGGCGCTCGGCATCGGCCCGGGGGACGAGGTCGTG
ACGGTCTCCAACACCGCGGCCCCCACCGTGGTGGCCATCGACGCCGTGGGCGCCACCCCC
GTCTTCGTCGACGTGCACGAGGAGAACTACCTCATGGACACCGGCCGGCTCCGGTCGGTG
ATCGGCCCGCGCACCCGGTGCCTGCTGCCCGTCCACCTCTACGGACAGAGCGTGGACATG
ACCCCCGTGCTCGAACTCGCCGCCGAGCACGACCTGAAGGTGCTGGAGGACTGCGCCCAG
GCCCACGGTGCCCGCCGTCACGGACGGCTGGTCGGCACCCAGGGGCATGCGGCGGCCTTC
TCCTTCTACCCGACCAAGGTCCTCGGTGCCTACGGTGACGGCGGCGCCGTCGTCACGCCG
GACGCGGAAGTCGACCGGCGGCTGCGGCGGTTGCGCTACTACGGCATGGGGGAGCGCTAC
TACGTCGTGGACACCCCCGGGCACAACAGCAGGCTCGACGAGGTGCAGGCCGAGATCCTG
CGCCGGAAACTGCGCCGCCTCGACGCCTATGTCGAGGGCCGCCGGGCCGTCGCCCGCCGC
TACGAGGAGGGACTCGGTGACCTCGACGGCCTGGTGCTGCCCACGATCGCCGAGGGCAAC
GACCACGTCTACTACGTGTACGTGGTGCGTCACCCCGAACGCGACCGCATCCTGGAGGCG
CTCACCGCCTACGACATCCATCTCAACATCAGCTACCCCTGGCCCGTCCACACCATGAGC
GGATTCGCCCACCTCGGCTACGGCCCCGGCGACCTGCCGGTGACCGAACGGCTGGCCGGC
GAGATCTTCTCCCTGCCGATGTACCCCTCGCTGCGTCCCGACGCGCAGGAGAAGGTGATC
GACGCGGTGCGGGAGGTCGTCGGAAGCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-369]  1.39999277195148e-95 PIRSF000390
PIRSF000390   PLP_StrS
 [15-364]  4.40000000000003e-121 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [16-246]  2.50000000000001e-75 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-368]  1.09999999999999e-38 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [16-370]  1.39999277195148e-106 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit