close all open/close all

CDS information : Adria_00230


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction24,018 / 24,773 / + [in whole cluster]
28 / 783 / + [in contig]
Location24018..24773 [in whole cluster]
28..783 [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative aklaviketone C-7 ketoreductase
Product (GenBank)daunorubicin-doxorubicin polyketide synthase
GenednrE
Gene (GenBank)dnrH
EC number
Keyword
Note
Note (GenBank)
  • protein H; putative
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
[8955419] Enhanced antibiotic production by manipulation of the Streptomyces peucetius dnrH and dnmT genes involved in doxorubicin (adriamycin) biosynthesis. (J Bacteriol. , 1996)
Related Reference
ACC
Q53882
NITE
Dauno_00060
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative aklaviketone C-7 ketoreductase [daunorubicin-doxorubicin polyketide synthase]
MENTQRSVIVTGGGSGIGRAVARAFAARGDRVLVVGRTAGPLAETVDGHKDAHTLAVDIT
DPAAPEAVVREVRERLGGVVDVLVNNAATAAFGHLGELHRTAVEAQVATNLVAPVLLTQA
LLGPLETASGLVVNIGSAGALGRRAWPGNAVYGAAKAGLDLLTRSWAVELGPRGIRVVGV
APGVIGTGAGVRAGMSQEAYDGFLEAMGQRVPLGRVGRPEDVAWWVVRLADPEAAYASGA
VLAVDGGLSVT
selected fasta
>putative aklaviketone C-7 ketoreductase [daunorubicin-doxorubicin polyketide synthase]
ATGGAGAACACACAGCGATCCGTGATCGTGACCGGCGGCGGCTCCGGCATCGGACGAGCC
GTCGCCCGCGCCTTCGCCGCCCGGGGCGACCGCGTCCTCGTCGTGGGCAGGACCGCCGGT
CCGCTGGCCGAGACGGTGGACGGGCACAAGGACGCGCACACGTTGGCCGTGGACATCACC
GACCCCGCGGCGCCGGAGGCGGTCGTCCGGGAGGTGCGCGAGCGGCTCGGCGGCGTGGTC
GACGTGCTCGTGAACAATGCCGCCACGGCCGCCTTCGGGCACCTGGGAGAGCTGCACCGC
ACCGCGGTGGAGGCACAGGTGGCCACGAACCTCGTGGCCCCCGTGCTGCTCACCCAGGCC
CTGCTCGGCCCCCTGGAGACCGCTTCCGGCCTGGTGGTGAACATCGGTTCGGCGGGCGCA
CTCGGCCGGCGGGCCTGGCCGGGGAACGCGGTGTACGGGGCGGCCAAGGCCGGCCTGGAC
CTGCTGACGCGGTCCTGGGCCGTGGAACTCGGTCCCCGCGGCATTCGCGTGGTCGGTGTC
GCCCCGGGAGTGATCGGGACGGGCGCGGGGGTCCGGGCCGGGATGTCCCAGGAGGCGTAC
GACGGGTTCCTGGAAGCCATGGGGCAGCGCGTCCCGCTCGGCCGTGTGGGCCGGCCCGAG
GACGTCGCGTGGTGGGTGGTGCGGCTCGCCGATCCCGAAGCCGCGTACGCCAGCGGTGCC
GTGCTGGCCGTGGACGGGGGTCTCTCGGTGACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [78-89]  1.29999924468179e-09 PR00080 [130-138]  1.29999924468179e-09 PR00080 [152-171]  1.29999924468179e-09 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [7-24]  2.1000026783403e-35 PR00081 [78-89]  2.1000026783403e-35 PR00081 [124-140]  2.1000026783403e-35 PR00081 [152-171]  2.1000026783403e-35 PR00081 [173-190]  2.1000026783403e-35 PR00081 [212-232]  2.1000026783403e-35 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-250]  2.59999999999995e-69 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-26]  0.522 Signal
Bacteria, Gram-positive   
TMHMM No significant hit