close all open/close all

CDS information : Adria_00240


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction25,855 / 24,908 / - [in whole cluster]
1,865 / 918 / - [in contig]
Locationcomplement(24908..25855) [in whole cluster]
complement(918..1865) [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)daunorubicin-doxorubicin polyketide synthase
Gene
Gene (GenBank)dpsF
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • protein F; putative
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>cyclase/dehydratase [daunorubicin-doxorubicin polyketide synthase]
MSELPLQQTEHEIHTSAAPDAVFAVLADARAWPAVFPPSVHVEQVEHTGSSERIRIWATA
NGSLRTWTSRRELDERARRIRFRQEVSAHPVAAMGGEWIVEEAGDGGTRVRLTHDFRAVD
DDPETIGWIHRAVDRNSEAELASLRTALERPDGTAPTTFEDTVVVRGRAEDVYDFLHRSD
LWKKRLSHVARIAVKEEEPGLQHMEMDTLTADGSVHTTASVRVCFPERRVIVYKQLRTPP
LLALHLGRWSVRPADDGDGIAVTSAHTVSVARSAIPGVLGAGASETDAVDFVRRALGRNS
LLTLEAARQYAESSA
selected fasta
>cyclase/dehydratase [daunorubicin-doxorubicin polyketide synthase]
ATGTCCGAGTTGCCGCTTCAGCAGACCGAGCACGAGATCCACACCTCCGCCGCGCCGGAC
GCCGTGTTCGCCGTGCTGGCCGACGCACGGGCCTGGCCCGCCGTGTTCCCGCCCAGTGTC
CACGTCGAACAGGTCGAGCACACCGGCTCCAGCGAGCGCATCCGCATCTGGGCCACCGCC
AACGGCTCGCTGCGCACCTGGACGTCGCGGCGCGAGCTCGACGAGCGGGCCCGGCGCATC
CGTTTCCGGCAGGAGGTGTCCGCCCATCCCGTCGCCGCCATGGGCGGCGAATGGATCGTC
GAGGAAGCCGGCGACGGCGGCACCCGGGTGCGGCTGACGCACGACTTCCGGGCCGTGGAC
GACGACCCGGAGACGATCGGCTGGATCCACCGGGCCGTGGACCGCAACAGCGAAGCGGAA
CTGGCGTCCCTGCGCACCGCGCTGGAACGACCCGACGGCACCGCGCCGACGACCTTCGAG
GACACCGTCGTCGTCCGCGGCCGTGCCGAGGACGTCTACGACTTCCTCCACCGCAGCGAC
CTCTGGAAGAAGCGGCTCTCCCACGTCGCGCGGATCGCGGTCAAGGAGGAGGAACCGGGG
CTCCAGCACATGGAGATGGACACCCTCACCGCGGACGGCTCGGTGCACACCACCGCGTCG
GTGCGAGTGTGCTTCCCCGAACGCCGCGTCATCGTCTACAAGCAGCTGCGCACGCCGCCG
CTGCTCGCGCTCCATCTCGGCCGTTGGTCGGTCCGTCCCGCCGACGACGGGGACGGGATC
GCCGTCACGTCGGCCCACACCGTGTCCGTGGCCCGCTCGGCGATCCCCGGCGTCCTCGGT
GCGGGGGCGAGTGAGACGGACGCCGTGGACTTCGTCCGCCGGGCCCTGGGCCGCAACAGT
CTGCTGACCCTGGAAGCGGCCAGGCAGTACGCCGAGTCCAGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [8-149]  2.6e-16 PF10604 [158-311]  2.8e-06 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [9-117]  6.80000000000001e-12 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit