close all open/close all

CDS information : Adria_00250


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction26,670 / 25,885 / - [in whole cluster]
2,680 / 1,895 / - [in contig]
Locationcomplement(25885..26670) [in whole cluster]
complement(1895..2680) [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productpolyketide C-9 ketoreductase
Product (GenBank)daunorubicin-doxorubicin polyketide synthase
Gene
Gene (GenBank)dpsE
EC number
Keyword
Note
Note (GenBank)
  • protein E; putative
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>polyketide C-9 ketoreductase [daunorubicin-doxorubicin polyketide synthase]
MSEAADRVALVTGGTSGIGLAVVRKLAQDGTRVFLCARDESAITGTVKELQASGLEVDGA
PCDVRSTADVDRLVQTARNRFGPIDIVVNNAGRGGGGVTAEITDDLWLDVVDTNLSGAFR
VTRAVLTGGAMQEHGWGRIISIASTGGKQGVALGAPYSASKSGLIGFTKAVALELAKTGI
TVNAVCPGYVETPMAQGVRQRYAAFWGITEDDVLEKFQAKIPLGRYSMPEEVAGMVHYLA
SDSADSITAQAINVCGGLGSY
selected fasta
>polyketide C-9 ketoreductase [daunorubicin-doxorubicin polyketide synthase]
ATGTCCGAGGCAGCCGACCGGGTCGCACTCGTCACCGGGGGAACCAGCGGCATCGGTCTC
GCGGTGGTGCGCAAGCTCGCCCAGGACGGGACCCGGGTGTTCCTGTGCGCTCGTGACGAG
AGCGCCATCACCGGCACCGTGAAGGAACTTCAGGCATCGGGACTGGAGGTGGACGGCGCG
CCCTGCGACGTGCGGAGCACCGCCGACGTCGACCGGCTGGTCCAAACGGCCCGGAACCGC
TTCGGGCCGATCGACATCGTCGTCAACAACGCCGGCCGCGGCGGTGGAGGCGTGACCGCC
GAGATCACGGACGACCTGTGGCTCGACGTCGTCGACACCAACCTCAGCGGGGCCTTCCGG
GTCACCCGCGCCGTCCTCACCGGCGGCGCCATGCAGGAGCACGGCTGGGGCCGGATCATC
AGCATCGCCTCCACCGGCGGCAAGCAGGGAGTGGCCCTCGGCGCCCCCTACTCCGCCTCC
AAGAGCGGCCTGATCGGCTTCACGAAGGCCGTCGCGCTGGAGCTGGCCAAGACGGGCATC
ACCGTCAACGCCGTCTGCCCCGGGTACGTCGAGACGCCCATGGCACAGGGCGTGCGGCAG
CGCTACGCCGCCTTCTGGGGGATCACCGAGGACGACGTCCTGGAGAAGTTCCAGGCGAAG
ATCCCCCTCGGACGCTACTCGATGCCCGAGGAGGTGGCCGGGATGGTGCACTACCTGGCC
TCCGACAGCGCCGACTCGATCACGGCCCAGGCCATCAACGTCTGTGGTGGCCTCGGCAGC
TACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [82-93]  2.39999798157265e-13 PR00080 [137-145]  2.39999798157265e-13 PR00080 [157-176]  2.39999798157265e-13 PR00080
PR00080   SDRFAMILY
 [8-175]  1.99999999999999e-38 PF00106
PF00106   adh_short
 [3-248]  1.89999859865864e-15 PIRSF000126
PIRSF000126   11-beta-HSD1
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  1.99999636034521e-48 PR00081 [82-93]  1.99999636034521e-48 PR00081 [131-147]  1.99999636034521e-48 PR00081 [157-176]  1.99999636034521e-48 PR00081 [178-195]  1.99999636034521e-48 PR00081 [222-242]  1.99999636034521e-48 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [3-258]  1e-82 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [144-172]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit