close all open/close all

CDS information : Adria_00260


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction26,862 / 27,251 / + [in whole cluster]
2,872 / 3,261 / + [in contig]
Location26862..27251 [in whole cluster]
2872..3261 [in contig]
TypeCDS
Length390 bp (129 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-12 oxygenase
Product (GenBank)anthraquinol monooxygenase
GenednrG
Gene (GenBank)
EC number
Keyword
  • anthraquinone
Note
Note (GenBank)
  • ORF8; putative
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)
ACC
O54259
NITE
Nogl_00350
PmId
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)

close this sectionSequence

selected fasta
>putative C-12 oxygenase [anthraquinol monooxygenase]
MPQPEPNDAGSGSVTFVNRFTLSGSAEDFEAAFAETAEFLCRRPGFRWHALLVPADTGPG
SADARPQYVNIAVWDDEASFRAAVAHPEFPAHAAALRALSTSEPTLYRHRQIRVAPDVPA
VSGPGGRTT
selected fasta
>putative C-12 oxygenase [anthraquinol monooxygenase]
ATGCCACAGCCAGAACCGAACGACGCCGGCTCCGGGTCGGTGACGTTCGTCAACCGATTC
ACCCTGAGCGGATCCGCCGAGGACTTCGAGGCGGCGTTCGCCGAAACGGCCGAGTTCCTG
TGTCGCCGGCCCGGCTTCCGCTGGCACGCCCTGCTGGTGCCGGCCGACACCGGTCCCGGC
TCGGCGGACGCCCGCCCGCAGTACGTGAACATCGCGGTCTGGGACGACGAGGCCTCCTTC
CGCGCCGCCGTGGCACACCCGGAGTTCCCGGCCCACGCGGCCGCCCTTCGGGCCCTGAGC
ACCAGCGAACCGACCCTGTACCGGCACCGTCAGATCCGTGTCGCGCCGGACGTCCCGGCC
GTGAGCGGGCCCGGAGGGCGGACGACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [14-94]  5.20000000000001e-20 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [4-121]  1.99999636034521e-19 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP
 [1-31]  0.329 Signal
Bacteria, Gram-positive   
 [1-26]  0.281 Signal
Bacteria, Gram-negative   
TMHMM No significant hit