close all open/close all

CDS information : Adria_00270


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction27,248 / 28,507 / + [in whole cluster]
3,258 / 4,517 / + [in contig]
Location27248..28507 [in whole cluster]
3258..4517 [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)daunorubicin-doxorubicin polyketide synthase
Gene
Gene (GenBank)dpsA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • protein A
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
Related Reference
ACC
Q55223
NITE
Dauno_00160
PmId
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [daunorubicin-doxorubicin polyketide synthase]
MNRRIVITGIGVVAPGAVGTKPFWELLLSGTTATRAISTFDATPFRSRIAAECDFDPVAA
GLSAEQARRLDRAGQFALVAGQEALADSGLRIDEDSAHRVGVCVGTAVGCTQKLESEYVA
LSAGGAHWVVDPGRGSPELYDYFVPSSLAAEVAWLAGAEGPVNIVSAGCTSGIDSIGYAC
ELIREGTVDAMVAGGVDAPIAPITVACFDAIRATSDHNDTPETASRPFSRSRNGFVLGEG
GAIVVLEEAEAAVRRGARIYAEIGGYASRGNAYHMTGLRADGAEMAAAITAALDEARRDP
SDVDYVNAHGTATKQNDRHETSAFKRSLGEHAYRVPISSIKSMIGHSLGAVGSLEVAATA
LAVEYGVIPPTANLHDPDPELDLDYVPLTAREKRVRHALTVGSGFGGFQSAMLLSRLER
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [daunorubicin-doxorubicin polyketide synthase]
GTGAACCGGCGGATCGTCATCACCGGGATCGGCGTGGTGGCTCCCGGCGCCGTCGGGACC
AAGCCGTTCTGGGAGCTGCTGCTGTCCGGAACCACCGCCACCCGCGCCATCAGCACTTTC
GACGCCACGCCCTTCCGTTCCCGTATCGCCGCCGAGTGCGACTTCGATCCGGTGGCGGCG
GGGCTGTCCGCGGAGCAGGCCCGGCGCCTCGACCGGGCCGGGCAGTTCGCGCTGGTCGCC
GGTCAGGAGGCGCTCGCCGACAGCGGGCTGCGAATCGATGAGGACTCCGCGCACCGGGTC
GGGGTGTGCGTGGGCACCGCCGTCGGCTGCACGCAGAAACTGGAGTCCGAGTACGTCGCT
CTCAGCGCGGGCGGAGCGCACTGGGTCGTGGACCCCGGCCGGGGGTCGCCCGAGCTGTAC
GACTACTTCGTGCCGAGTTCCCTCGCCGCCGAAGTGGCCTGGCTCGCCGGGGCGGAGGGG
CCCGTGAACATCGTCTCGGCCGGGTGCACCTCGGGGATCGACTCCATCGGGTACGCCTGC
GAGCTCATCCGCGAGGGGACGGTGGACGCCATGGTCGCGGGAGGCGTGGACGCACCCATC
GCGCCGATCACGGTGGCCTGCTTCGACGCCATCAGGGCGACCTCCGACCACAACGACACC
CCCGAGACCGCCTCGCGTCCCTTCAGCCGCAGCCGCAACGGCTTTGTGCTGGGCGAGGGC
GGTGCGATCGTGGTCCTGGAAGAGGCGGAGGCGGCCGTGCGCAGGGGCGCGCGGATCTAC
GCCGAGATCGGCGGGTACGCCTCACGCGGCAACGCGTACCACATGACCGGGCTGCGCGCA
GACGGCGCCGAGATGGCGGCGGCGATCACCGCGGCCCTCGACGAGGCCCGCCGCGACCCC
TCGGACGTGGACTACGTCAACGCCCACGGAACGGCGACGAAGCAGAACGACCGGCACGAG
ACCTCCGCGTTCAAGCGCTCCCTGGGGGAGCACGCGTACCGGGTGCCCATCAGCTCCATC
AAGTCGATGATCGGTCACTCCCTGGGCGCTGTCGGCTCGCTCGAAGTGGCGGCGACCGCA
CTGGCCGTGGAGTACGGGGTGATCCCGCCGACCGCGAATCTGCACGACCCGGATCCGGAA
CTCGACCTGGACTACGTGCCGCTGACGGCACGAGAAAAGCGGGTGCGGCACGCGCTGACG
GTGGGCAGCGGCTTCGGCGGCTTCCAGAGCGCCATGCTGCTGAGCCGTCTCGAGAGGTGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-251]  9.40000000000003e-60 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  3.60000000000002e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-263]  1.2e-64 G3DSA:3.40.47.10 [270-417]  6.29999999999998e-52 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  5.50001754266469e-67 SSF53901 [219-418]  3.89999861795218e-64 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-20]  0.582 Signal
Bacteria, Gram-negative   
 [1-19]  0.845 Signal
Eukaryota   
TMHMM No significant hit