close all open/close all

CDS information : Adria_00280


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction28,513 / 29,790 / + [in whole cluster]
4,523 / 5,800 / + [in contig]
Location28513..29790 [in whole cluster]
4523..5800 [in contig]
TypeCDS
Length1,278 bp (425 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)daunorubicin-doxorubicin polyketide synthase
Gene
Gene (GenBank)dpsB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • protein B
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)

close this sectionPKS/NRPS Module

CLF26..382

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [daunorubicin-doxorubicin polyketide synthase]
MTGTAARTASSQLHASPAGRRGLRGRAVVTGLGIVAPNGLGVGAYWDAVLNGRNGIGPLR
RFTGDGRLGRLAGEVSDFVPEDHLPKRLLAQTDPMTQYALAAAEWALRESGCSPSSPLEA
GVITASASGGFAFGQRELQNLWSKGPAHVSAYMSFAWFYAVNTGQIAIRHDLRGPVGVVV
AEQAGGLDALAHARRKVRGGAELIVSGAVDSSLCPYGMAAQVKSGRLSGSDNPTAGYLPF
DRRAAGHVPGEGGAILTVEDAERAAERGAKVYGSIAGYGASFDPPPGSGRPSALARAVET
ALADAGLDGSDIAVVFADGAAVPELDAAEAEALASVFGPRRVPVTVPKTLTGRLYSGAGP
LDVATALLALRDEVVPATAHVDPDPDLPLDVVTGRPRSLADARAALLVARGYGGFNSALV
VRGAA
selected fasta
>polyketide synthase chain length factor subunit [daunorubicin-doxorubicin polyketide synthase]
ATGACAGGTACCGCGGCACGGACCGCGTCTTCGCAGCTCCACGCATCGCCCGCGGGCCGA
CGGGGCCTCAGGGGCCGCGCGGTGGTGACGGGTCTCGGGATCGTCGCCCCCAACGGGCTG
GGGGTGGGCGCGTATTGGGACGCCGTCCTGAACGGCCGCAACGGCATCGGACCGCTGCGG
CGGTTCACCGGCGACGGCCGCCTGGGCCGGCTGGCCGGTGAGGTGAGCGACTTCGTCCCC
GAGGACCATCTGCCGAAGCGGCTGCTGGCGCAGACCGATCCGATGACCCAGTACGCGCTG
GCCGCCGCGGAGTGGGCCCTGCGGGAGTCCGGCTGCTCCCCGTCCTCGCCGCTGGAGGCG
GGGGTGATCACGGCCAGCGCGTCCGGCGGCTTCGCCTTCGGCCAGCGGGAGTTGCAGAAT
CTTTGGAGCAAGGGACCGGCCCACGTCAGCGCCTACATGTCGTTCGCCTGGTTCTACGCC
GTCAACACCGGGCAGATCGCCATCCGGCACGATCTGCGCGGCCCGGTCGGCGTGGTGGTG
GCCGAGCAGGCGGGCGGCCTCGACGCCCTCGCCCACGCTCGCCGCAAGGTCCGGGGCGGA
GCCGAGCTGATCGTCTCGGGCGCCGTGGACTCGTCGCTGTGCCCGTACGGCATGGCGGCC
CAGGTGAAGTCCGGCCGGCTGAGCGGCTCGGACAACCCGACAGCCGGGTATCTGCCGTTC
GACCGGCGGGCGGCCGGACATGTGCCCGGCGAGGGAGGCGCGATCCTCACCGTCGAGGAC
GCGGAGCGGGCCGCCGAGCGGGGCGCGAAAGTGTACGGGTCGATCGCCGGGTACGGCGCG
AGCTTCGACCCGCCGCCCGGCTCCGGCCGCCCCTCCGCCCTCGCCCGTGCCGTCGAGACG
GCGCTGGCCGACGCCGGGCTGGACGGCTCCGACATAGCCGTGGTGTTCGCCGACGGCGCG
GCCGTCCCCGAACTGGACGCAGCCGAGGCGGAGGCTCTGGCGTCGGTCTTCGGGCCGCGC
CGGGTCCCGGTGACCGTCCCCAAGACTCTCACCGGCCGGCTGTATTCGGGCGCCGGGCCG
CTGGACGTGGCGACCGCGCTGCTGGCGCTGCGGGACGAGGTGGTCCCGGCGACCGCCCAC
GTCGACCCCGACCCGGACCTGCCGCTCGACGTGGTGACCGGGCGGCCCCGGTCCCTGGCC
GACGCCAGGGCGGCCCTCCTCGTCGCCCGCGGCTACGGGGGCTTCAACAGCGCTCTGGTG
GTCCGGGGGGCGGCGTGA
CLF26..382
CLF76..1146

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [26-261]  5.49999999999995e-46 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [272-382]  5.00000000000001e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [26-277]  2.4e-49 G3DSA:3.40.47.10 [290-423]  2.1e-35 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [24-269]  2.1000026783403e-53 SSF53901 [232-424]  8.00002659346736e-43 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-15]  0.528 Signal
Bacteria, Gram-negative   
 [1-43]  0.739 Signal
Eukaryota   
TMHMM
 [28-50]  Transmembrane (i-o)
Transmembrane 1