close all open/close all

CDS information : Adria_00290


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction29,787 / 30,848 / + [in whole cluster]
5,797 / 6,858 / + [in contig]
Location29787..30848 [in whole cluster]
5797..6858 [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)daunorubicin-doxorubicin polyketide synthase
Gene
Gene (GenBank)dpsC
EC number
Keyword
  • propionyl-CoA dependent
  • type II PKS
Note
Note (GenBank)
  • protein C
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
[10423255] Purification and properties of the Streptomyces peucetius DpsC beta-ketoacyl:acyl carrier protein synthase III that specifies the propionate-starter unit for type II polyketide biosynthesis. (Biochemistry. , 1999)
Related Reference
ACC
Q55225
NITE
Dauno_00180
PmId
[11162232] The product of dpsC confers starter unit fidelity upon the daunorubicin polyketide synthase of Streptomyces sp. strain C5. (Metab Eng. , 2001)

close this sectionPKS/NRPS Module

KS113..339

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [daunorubicin-doxorubicin polyketide synthase]
MSVPQGAPGDLYVAGCGVWLPPPVTTEQALAAGHCDRRLASSTRMLSVAVADKETPAEMA
ALAAQTALDRSGVAPAHVDLVLHASLYFQGHHLWAPSSYVQRVAVGNRCPAMEVRQVSNG
GMAALELARAYLLAAPDRVAALITTGDRMHPPGFDRWSSDPGTVYADGGTALVLSRQGGF
ARLRSLVTVSEPVLEGMHRGGHPFGPPSPEEQRAVDLDAHKRAYVAEAGSSFSVARVSAG
QEEALTGALEAAGAGLDDISRVVLPHMGWRRLSAAYFNKWHIQPERTTWEFGRRTGHLGG
GDPIAGFDHLVGSGRLAPGELCLLVSVGAGFSWSCAVVELLERPSWAAAPAAR
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [daunorubicin-doxorubicin polyketide synthase]
GTGAGCGTGCCGCAGGGGGCGCCCGGGGACCTTTACGTGGCCGGTTGCGGCGTCTGGCTG
CCCCCGCCGGTGACCACGGAACAGGCCCTGGCCGCCGGCCACTGCGACCGCAGGCTCGCC
TCCTCGACGCGGATGCTGTCGGTGGCGGTCGCCGACAAGGAGACACCGGCCGAAATGGCG
GCCTTGGCGGCCCAGACCGCTCTGGACCGCTCCGGCGTCGCACCGGCCCACGTCGACCTC
GTCCTGCACGCCAGTCTGTACTTCCAGGGGCACCATCTGTGGGCTCCCTCCTCCTACGTC
CAGCGGGTGGCCGTCGGGAACCGCTGCCCCGCCATGGAGGTGCGGCAGGTGTCCAACGGC
GGCATGGCCGCCCTGGAACTGGCCCGCGCGTACCTGCTTGCCGCCCCGGACCGGGTGGCC
GCTCTCATCACGACAGGCGACCGGATGCATCCGCCGGGCTTCGACCGCTGGAGCAGCGAC
CCCGGCACGGTGTACGCCGACGGTGGTACCGCCCTCGTGCTGTCCCGGCAGGGCGGTTTC
GCCCGGCTGCGCAGCCTGGTGACGGTCTCCGAACCGGTGCTGGAGGGCATGCACCGGGGC
GGGCACCCGTTCGGCCCGCCGTCTCCGGAGGAGCAGCGGGCCGTGGACCTGGACGCGCAC
AAGCGGGCGTACGTGGCCGAGGCGGGAAGCTCGTTCAGCGTCGCCCGGGTCTCGGCGGGC
CAGGAGGAGGCTCTGACCGGCGCGCTGGAGGCGGCCGGGGCCGGACTCGACGACATCAGC
CGGGTCGTGCTGCCGCACATGGGGTGGCGCCGGCTGAGCGCCGCCTACTTCAACAAGTGG
CACATCCAACCCGAGCGGACCACTTGGGAGTTCGGGCGGCGGACCGGCCACCTGGGGGGC
GGTGACCCGATCGCCGGGTTCGACCACCTTGTGGGCTCCGGCCGCCTCGCCCCGGGGGAG
CTGTGTCTGCTGGTCAGCGTCGGCGCCGGCTTCAGCTGGTCGTGCGCCGTCGTGGAGTTG
CTGGAACGCCCGTCGTGGGCGGCCGCCCCGGCCGCCCGGTGA
KS113..339
KS337..1017

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [249-339]  6.00000000000001e-20 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [113-179]  4.69999999999999e-06 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [10-170]  3e-19 G3DSA:3.40.47.10 [171-339]  1.8e-20 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-343]  1.20000117458134e-27 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit