close all open/close all

CDS information : Adria_00300


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction30,859 / 31,872 / + [in whole cluster]
6,869 / 7,882 / + [in contig]
Location30859..31872 [in whole cluster]
6869..7882 [in contig]
TypeCDS
Length1,014 bp (337 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative acyl-ACP thioesterase
Product (GenBank)daunorubicin-doxorubicin polyketide synthase
Gene
Gene (GenBank)dpsD
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
  • protein D; putative
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
Related Reference
ACC
Q55226
NITE
Dauno_00190
PmId
[11162232] The product of dpsC confers starter unit fidelity upon the daunorubicin polyketide synthase of Streptomyces sp. strain C5. (Metab Eng. , 2001)
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)
ACC
Q9KHK3
NITE
Enter_00120
PmId
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)

close this sectionSequence

selected fasta
>putative acyl-ACP thioesterase [daunorubicin-doxorubicin polyketide synthase]
MDAPAILLMFPGQGSQHARMAVGLYGSEPAFTAAMDEVFDAYDDAGDSEGGRLRADWLSD
HPAVPLDHVTRSQPLLFAVDYALGRMVMATTGRPWALLGHSVGEMAAAALAGVFTLRDAA
GLLLDRVRRLAQAPPGGMLAVAAAEDVLGPYLGNGEVVVAAVNSPRQTILAGPVASLAGV
ARALREAGLTCREVPSLTAFHSPMLAPIAAGAAERFASTRVAPSIPLRSGYRPGAVTGQL
AADPSYWAGHPLETVRFWPALDAMLGSRTGVVCLETGPGQGLSTIARRHPTVRFGKNSVV
PLLPPQAGTAEVDRTSVAAALAAVREQGTVLSGRPGR
selected fasta
>putative acyl-ACP thioesterase [daunorubicin-doxorubicin polyketide synthase]
ATGGATGCGCCCGCGATTCTCCTGATGTTCCCCGGGCAGGGGTCCCAGCATGCGCGGATG
GCCGTCGGCCTGTACGGATCCGAACCGGCCTTCACGGCCGCCATGGACGAGGTCTTCGAC
GCGTACGACGACGCCGGCGACAGTGAGGGCGGGCGGCTGCGTGCCGACTGGCTGAGCGAC
CATCCGGCCGTGCCATTGGACCACGTCACCCGGTCCCAGCCGTTGTTGTTCGCGGTGGAC
TACGCCCTCGGCCGGATGGTGATGGCCACGACGGGCCGGCCGTGGGCCCTGCTCGGGCAC
AGCGTCGGCGAAATGGCGGCGGCCGCGCTCGCCGGGGTGTTCACGCTGCGCGACGCGGCC
GGCCTCCTGCTGGACCGGGTGCGACGGCTGGCCCAGGCACCGCCCGGGGGAATGCTGGCG
GTCGCCGCGGCCGAGGACGTGCTGGGCCCGTATCTCGGGAATGGGGAGGTGGTGGTCGCG
GCCGTCAACTCGCCCCGCCAGACCATCCTCGCCGGACCCGTCGCATCGCTCGCCGGGGTC
GCCCGGGCGCTGCGGGAGGCAGGGCTTACGTGCCGTGAGGTGCCCTCGCTGACCGCCTTC
CACAGTCCGATGCTGGCCCCGATCGCGGCGGGGGCGGCCGAGCGGTTCGCATCCACGCGC
GTGGCGCCGTCCATCCCCCTCCGCTCCGGGTACCGGCCGGGTGCGGTGACCGGGCAACTG
GCCGCCGACCCGTCGTACTGGGCCGGGCATCCCCTGGAGACGGTCCGCTTCTGGCCGGCA
CTGGACGCGATGCTCGGCTCCCGCACGGGCGTCGTCTGCCTGGAGACGGGGCCGGGGCAG
GGGCTGAGCACCATCGCCCGCCGCCATCCGACGGTGCGGTTCGGGAAGAACTCGGTGGTG
CCGCTGCTGCCGCCGCAGGCCGGCACCGCCGAGGTGGACCGGACGTCCGTGGCGGCGGCG
CTGGCCGCGGTGCGCGAGCAGGGCACCGTGCTCAGTGGGCGACCCGGGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [3-132]  6.19999999999994e-42 G3DSA:3.40.366.10 [198-300]  6.19999999999994e-42 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [9-264]  5.49999999999995e-36 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [5-290]  5.6999970878395e-39 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [134-195]  8.29999581180007e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP No significant hit
TMHMM No significant hit