close all open/close all

CDS information : Adria_00310


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction32,710 / 31,850 / - [in whole cluster]
8,720 / 7,860 / - [in contig]
Locationcomplement(31850..32710) [in whole cluster]
complement(7860..8720) [in contig]
TypeCDS
Length861 bp (286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productaklanonic acid O-methyltransferase
Product (GenBank)
GenednrC
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • ORF5
Reference
ACC
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
Related Reference
ACC
Q55214
NITE
Dauno_00080
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>aklanonic acid O-methyltransferase
MQDSSYKEQVTQAFDQSSSTYDRLGVEFFTPMGRPLVEISEPVTGERVLDIGCGRGACLF
PAAEKVGPQGRVHGIDIAPGMIEEARKEAAERGLRNIALDVMDAETPELPARSFDLVMGS
YSVIFLPDAVGALARYAGILDHGGRIAFTSPVFRAGTFPFLPPEFTPLIPQALLEHLPEQ
WRPEALVRRFNSWLERAEDLLRTLERCGYTSVAVTDEPVRMTALSSEAWVDWSHTQGMRL
LWQNLPQAQRTELRARLVEGLDKLSDATGALAIDVPVRFVTARVAH
selected fasta
>aklanonic acid O-methyltransferase
GTGCAGGATTCGTCCTACAAAGAGCAGGTAACTCAGGCCTTCGACCAGTCGTCGTCGACC
TACGACCGACTGGGAGTGGAATTCTTCACGCCCATGGGTCGGCCCCTGGTGGAAATCTCG
GAGCCGGTCACCGGTGAACGAGTGCTCGACATCGGCTGCGGGCGCGGCGCATGCCTTTTT
CCGGCTGCGGAAAAGGTCGGTCCTCAGGGGCGCGTCCACGGAATCGACATTGCTCCCGGA
ATGATCGAGGAAGCTCGCAAGGAAGCCGCCGAACGCGGTCTGCGGAATATCGCCCTCGAT
GTGATGGACGCGGAGACGCCCGAACTCCCGGCGCGCTCCTTCGACCTGGTCATGGGGAGC
TACAGCGTCATCTTCCTGCCGGACGCGGTGGGGGCGCTGGCGCGCTACGCCGGAATCCTG
GACCACGGCGGCAGGATCGCGTTCACCAGCCCGGTCTTCCGCGCCGGCACGTTCCCGTTC
CTGCCACCGGAGTTCACCCCGCTCATCCCGCAGGCGCTGCTGGAGCACCTGCCCGAGCAG
TGGCGGCCCGAGGCGCTGGTCCGGCGGTTCAACAGCTGGCTGGAGCGGGCCGAGGATCTC
CTCCGCACCCTGGAACGCTGCGGCTACACCTCGGTCGCCGTCACCGACGAGCCGGTGCGG
ATGACGGCCCTGTCCAGCGAGGCGTGGGTGGACTGGTCCCACACCCAGGGCATGCGTCTG
CTGTGGCAGAACCTCCCGCAGGCCCAGCGAACGGAACTGCGCGCACGGCTCGTCGAGGGA
CTCGACAAGCTGAGCGACGCCACCGGGGCCCTCGCCATCGACGTGCCCGTCCGCTTCGTC
ACCGCCCGGGTCGCCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit