close all open/close all

CDS information : Adria_00320


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction32,894 / 33,331 / + [in whole cluster]
167 / 604 / + [in contig]
Location32894..33331 [in whole cluster]
167..604 [in contig]
TypeCDS
Length438 bp (145 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productaklanonic acid methyl ester cyclase
Product (GenBank)methylaklanonic acid cyclase
Gene
Gene (GenBank)dnrD
EC number
Keyword
  • 4th ring
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[10200167] DnrD cyclase involved in the biosynthesis of doxorubicin: purification and characterization of the recombinant enzyme. (Biochemistry. , 1999)
Related Reference
ACC
Q55215
NITE
Dauno_00090
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>aklanonic acid methyl ester cyclase [methylaklanonic acid cyclase]
MSTQIDLVRRMVEAYNTGKTDDVAEFIHLEYLNPGALEHNPELRGPEAFAAAVTWLKYAF
SEEAHLEEIEYEENGPWVRAKLALYGRHVGNLVGMPATGRRFSGEQIHLIRIVDGKIRDH
RDWPDYLGTYRQLGEPWPTPEGWRP
selected fasta
>aklanonic acid methyl ester cyclase [methylaklanonic acid cyclase]
ATGAGCACGCAGATCGATCTGGTCCGCCGCATGGTGGAGGCATACAACACGGGAAAAACC
GACGATGTCGCGGAGTTCATTCACCTCGAGTACCTGAACCCCGGCGCGCTGGAGCACAAC
CCGGAGCTGCGCGGCCCGGAGGCGTTCGCGGCCGCCGTCACCTGGCTCAAGTACGCCTTC
TCCGAGGAGGCGCACCTGGAGGAGATCGAGTACGAGGAGAACGGCCCGTGGGTCCGGGCG
AAGCTCGCCCTCTACGGGCGGCACGTCGGCAACCTCGTCGGCATGCCGGCAACCGGGCGC
CGGTTCTCCGGTGAGCAGATCCACCTCATCCGCATCGTCGACGGCAAGATCCGCGATCAC
CGCGACTGGCCCGACTACCTCGGCACCTACCGCCAGCTCGGCGAGCCCTGGCCCACCCCC
GAGGGCTGGCGCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [6-133]  5.40000000000002e-34 PF07366
PF07366   SnoaL
SignalP No significant hit
TMHMM No significant hit