close all open/close all

CDS information : Adria_00330


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction33,377 / 34,447 / + [in whole cluster]
650 / 1,720 / + [in contig]
Location33377..34447 [in whole cluster]
650..1720 [in contig]
TypeCDS
Length1,071 bp (356 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-4 O-methyltransferase
Product (GenBank)carminomycin o-methyltransferase
Gene
Gene (GenBank)dnrK
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8509343] Cloning and sequencing of a gene encoding carminomycin 4-O-methyltransferase from Streptomyces peucetius and its expression in Escherichia coli. (J Bacteriol. , 1993)
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[15273252] Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products. (J Biol Chem. , 2004)
Related Reference
ACC
Q55216
NITE
Dauno_00100
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)
[9098063] In vivo and in vitro bioconversion of epsilon-rhodomycinone glycoside to doxorubicin: functions of DauP, DauK, and DoxA. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>C-4 O-methyltransferase [carminomycin o-methyltransferase]
MTAEPTVAARPQQIDALRTLIRLGSLHTPMVVRTAATLRLVDHILAGARTVKALAARTDT
RPEALLRLIRHLVAIGLLEEDAPGEFVPTEVGELLADDHPAAQRAWHDLTQAVARADISF
TRLPDAIRTGRPTYESIYGKPFYEDLAGRPDLRASFDSLLACDQDVAFDAPAAAYDWTNV
RHVLDVGGGKGGFAAAIARRAPHVSATVLEMAGTVDTARSYLKDEGLSDRVDVVEGDFFE
PLPRKADAIILSFVLLNWPDHDAVRILTRCAEALEPGGRILIHERDDLHENSFNEQFTEL
DLRMLVFLGGALRTREKWDGLAASAGLVVEEVRQLPSPTIPYDLSLLVLAPAATGA
selected fasta
>C-4 O-methyltransferase [carminomycin o-methyltransferase]
ATGACAGCCGAACCGACGGTCGCGGCCCGGCCGCAGCAGATCGACGCCCTCAGGACCCTG
ATCCGCCTCGGAAGCCTGCACACGCCCATGGTCGTCCGGACGGCCGCCACCCTGCGGCTC
GTCGACCACATCCTGGCCGGGGCCCGCACCGTGAAGGCCCTGGCGGCCAGGACAGACACC
CGGCCGGAAGCACTCCTGCGACTGATCCGCCACCTGGTGGCGATCGGACTGCTCGAGGAG
GACGCACCGGGCGAGTTCGTCCCGACCGAGGTCGGCGAGCTGCTCGCCGACGACCACCCA
GCCGCGCAGCGTGCCTGGCACGACCTGACGCAGGCCGTGGCGCGCGCCGACATCTCCTTC
ACCCGCCTCCCCGACGCCATCCGTACCGGCCGCCCCACGTACGAGTCCATCTACGGCAAG
CCGTTCTACGAGGACCTGGCCGGCCGCCCCGACCTGCGCGCGTCCTTCGACTCGCTGCTC
GCCTGCGACCAGGACGTCGCCTTCGACGCTCCGGCCGCCGCGTACGACTGGACGAACGTC
CGGCATGTGCTCGACGTGGGTGGCGGCAAGGGTGGTTTCGCCGCGGCCATCGCGCGCCGG
GCCCCGCACGTGTCGGCCACCGTGCTGGAGATGGCGGGCACCGTGGACACCGCCCGCTCC
TACCTGAAGGACGAGGGCCTCTCCGACCGTGTCGACGTCGTCGAGGGGGACTTCTTCGAG
CCGCTGCCCCGCAAGGCGGACGCGATCATCCTCTCTTTCGTCCTCCTCAACTGGCCGGAC
CACGACGCCGTCCGGATCCTCACCCGCTGCGCCGAGGCCCTGGAGCCCGGCGGGCGCATC
CTGATCCACGAGCGCGACGACCTCCACGAGAACTCGTTCAACGAACAGTTCACAGAGCTC
GATCTGCGGATGCTGGTCTTCCTCGGCGGTGCCCTGCGCACCCGCGAGAAGTGGGACGGC
CTGGCCGCGTCGGCGGGCCTCGTGGTCGAGGAGGTGCGGCAACTGCCGTCGCCGACCATC
CCGTACGACCTCTCGCTCCTCGTCCTTGCCCCCGCGGCCACCGGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [85-322]  4.30000000000003e-67 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-91]  2.6e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-334]  5.29999657550189e-13 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-35]  0.269 Signal
Bacteria, Gram-positive   
TMHMM No significant hit