close all open/close all

CDS information : Adria_00340


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction34,478 / 35,374 / + [in whole cluster]
1,751 / 2,647 / + [in contig]
Location34478..35374 [in whole cluster]
1751..2647 [in contig]
TypeCDS
Length897 bp (298 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative rhodomycin D esterase
Product (GenBank)10-carbomethoxy-13-deoxycarminomycin esterase
Gene
Gene (GenBank)dnrP
EC number
Keyword
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
Related Reference
ACC
Q55217
NITE
Dauno_00110
PmId
[9098063] In vivo and in vitro bioconversion of epsilon-rhodomycinone glycoside to doxorubicin: functions of DauP, DauK, and DoxA. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative rhodomycin D esterase [10-carbomethoxy-13-deoxycarminomycin esterase]
MPTRMITNDEVTLWSEGLGDPADAPLLLIAGGNLSAKSWPDEFVERLVAAGHFVIRYDHR
DTGRSSRCDFALHPYGFDELAADALAVLDGWQVRAAHVVGMSLGNTIGQLLALDAPERLL
TLTVMLGGALDVDFDADLEAALKGEPSVSGLPVPSQRFLDMMTMLQQPAETDEELLERRV
EKWRLLNGEGVPFDADEFRRRELLAAGHAGTFDEPIVHHMIPLPPVSRGAELSRVTTPVL
AIQAMCDPAAPPPHARHLANRIPGARVVEIENMGHALPLAVHEPLAAAICAHTRAATV
selected fasta
>putative rhodomycin D esterase [10-carbomethoxy-13-deoxycarminomycin esterase]
ATGCCGACACGCATGATCACCAACGATGAGGTGACCCTGTGGAGCGAAGGGCTCGGCGAT
CCGGCCGACGCCCCGTTGCTCCTGATCGCCGGCGGCAACCTCTCGGCCAAATCGTGGCCG
GACGAGTTCGTCGAACGCCTGGTCGCGGCCGGGCACTTCGTGATCCGCTACGACCACCGG
GACACCGGGCGCTCCTCCCGGTGCGACTTCGCGCTCCACCCCTACGGCTTCGACGAGCTG
GCCGCCGACGCGCTGGCCGTCCTGGACGGCTGGCAGGTCCGCGCCGCCCATGTGGTGGGC
ATGTCGCTGGGCAACACCATCGGCCAGCTGCTCGCCCTGGACGCTCCGGAGCGTCTCCTC
ACACTCACCGTGATGCTGGGGGGCGCGCTCGACGTCGACTTCGACGCCGACCTGGAGGCG
GCGCTCAAGGGTGAGCCTTCCGTCAGCGGACTGCCGGTGCCCAGCCAGCGGTTCCTCGAC
ATGATGACGATGCTTCAGCAACCGGCCGAGACGGACGAGGAACTGCTGGAGCGCCGAGTG
GAGAAGTGGCGCCTACTCAACGGGGAGGGAGTGCCCTTCGACGCCGACGAGTTCCGGCGT
CGTGAACTCCTGGCCGCCGGGCACGCGGGAACGTTCGACGAGCCGATCGTGCACCACATG
ATCCCGCTGCCGCCGGTGTCGCGGGGGGCGGAGTTGTCCCGCGTCACCACACCGGTACTG
GCGATCCAGGCGATGTGCGACCCCGCGGCCCCGCCGCCGCACGCCCGGCACCTCGCCAAC
CGGATTCCCGGCGCCCGGGTCGTGGAGATCGAGAACATGGGGCACGCCCTGCCCCTCGCG
GTCCACGAGCCGCTGGCCGCCGCCATCTGCGCCCACACCCGGGCCGCGACAGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit