close all open/close all

CDS information : Adria_00350


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction35,417 / 36,733 / + [in whole cluster]
32 / 1,348 / + [in contig]
Location35417..36733 [in whole cluster]
32..1348 [in contig]
TypeCDS
Length1,317 bp (438 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase helper protein
Product (GenBank)
Gene
Gene (GenBank)dnrQ
EC number
Keyword
  • daunosamine
Note
Note (GenBank)
Reference
ACC
PmId
[7592454] Cloning and characterization of the Streptomyces peucetius dnrQS genes encoding a daunosamine biosynthesis enzyme and a glycosyl transferase involved in daunorubicin biosynthesis. (J Bacteriol. , 1995)
[17049185] Functional analysis of desVIII homologues involved in glycosylation of macrolide antibiotics by interspecies complementation. (Gene. , 2007)
Related Reference
ACC
Q9L4U5
NITE
Acla_00220
PmId
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)
ACC
Q9ZGH8
NITE
Pikro_00080
PmId
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative glycosyltransferase helper protein
MPTPTSAPPAAPTDSELGRHLLTVRGFHFVFGALGDPYARRLRGEADHLSLGELVRDRGP
LHGSALGTWVTADGGISARLLDDPLLGPRHPASEGPQEHVLENVWETWRTCHVTPLGEDL
LTPAAADSDRLAALLGPVLGPRTCTAWQVDAGRAVHRVLDGLPPHFDVVSDLARPAIAGS
LAAVLGLPDEARAELPDLLAACGPVLDSALCPPRLPVARAMTQALRRVRELMAAAVANHL
TAPADGAVSALLAVDPGGGRDPGDTVTAAVLSTVVGAETAITTVANAVMALLKHDEQWSL
LRADPGRAADAVEETLRWAPPVTLRSLITQGEVQIGGETLEADQHVVVLVDAAQRDPALY
EDPDRFRLDRPRSPGFTHMALAGRDHLGLVAPLVRVQCTAVLRALAERLPGLRAEGEPLR
RGRSPVVRAPLSLRLAQK
selected fasta
>putative glycosyltransferase helper protein
ATGCCCACACCCACGTCCGCGCCGCCGGCCGCCCCGACCGACAGCGAGCTGGGGCGCCAT
CTGCTGACCGTGCGCGGCTTCCACTTCGTCTTCGGCGCGCTGGGCGACCCCTATGCCCGG
CGACTGCGCGGCGAGGCCGATCATCTGTCCCTCGGTGAGCTGGTCCGCGACCGGGGCCCG
CTCCACGGCAGTGCGCTGGGCACGTGGGTGACGGCGGACGGCGGAATATCGGCCCGCCTG
CTGGACGATCCGCTGCTGGGTCCCCGGCACCCCGCCTCAGAGGGCCCGCAGGAGCACGTT
CTCGAGAACGTCTGGGAGACCTGGCGGACCTGTCACGTCACTCCGCTCGGCGAGGACCTG
CTGACGCCGGCCGCCGCCGACTCCGACCGTCTCGCAGCCCTGCTCGGTCCGGTCCTCGGG
CCCCGTACGTGCACCGCGTGGCAGGTCGACGCGGGGCGTGCGGTGCACCGGGTGCTGGAC
GGCCTGCCGCCGCACTTCGACGTGGTATCGGATCTGGCCCGGCCTGCGATCGCGGGCTCG
CTCGCCGCCGTCCTGGGTCTCCCGGACGAGGCACGGGCGGAACTGCCGGACCTGCTGGCC
GCCTGCGGCCCGGTGCTCGACTCCGCCCTCTGCCCGCCGCGCCTCCCGGTGGCCCGGGCG
ATGACGCAGGCGCTGCGCCGCGTCCGGGAGCTGATGGCGGCGGCCGTGGCCAACCACCTC
ACCGCACCGGCCGACGGTGCGGTGAGCGCCCTGCTGGCCGTGGACCCCGGCGGCGGACGC
GATCCCGGGGACACCGTCACGGCCGCAGTGCTGAGCACGGTGGTCGGAGCCGAGACAGCG
ATCACCACCGTGGCGAACGCCGTCATGGCTCTGCTGAAGCACGACGAGCAGTGGTCGCTG
CTGCGGGCCGATCCCGGCAGGGCGGCGGACGCGGTCGAGGAGACCCTGCGCTGGGCGCCG
CCTGTGACGCTGCGCAGCCTGATCACCCAGGGAGAGGTTCAGATCGGTGGCGAGACGCTG
GAGGCGGACCAGCACGTGGTGGTGCTGGTCGACGCCGCCCAGCGGGACCCGGCGCTGTAC
GAGGACCCGGACCGATTCCGTCTCGACCGCCCCCGTAGCCCCGGTTTCACGCACATGGCC
CTGGCGGGCCGGGACCATCTGGGGCTGGTCGCCCCGCTCGTCCGCGTGCAGTGCACCGCC
GTCCTGCGGGCGCTTGCCGAACGGCTGCCCGGGCTGCGGGCCGAGGGCGAGCCGCTGCGG
CGCGGGCGCTCCCCTGTGGTCCGCGCCCCGCTCTCGCTGCGGCTGGCCCAGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [53-435]  1.40000000000001e-48 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [311-371]  6e-08 PF00067
PF00067   p450
 [48-435]  5.09998762524166e-44 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [167-183]  2.60000517657733e-17 PR00359 [184-199]  2.60000517657733e-17 PR00359 [230-252]  2.60000517657733e-17 PR00359 [310-321]  2.60000517657733e-17 PR00359 [327-354]  2.60000517657733e-17 PR00359 [355-370]  2.60000517657733e-17 PR00359
PR00359   BP450
SignalP
 [1-35]  0.232 Signal
Eukaryota   
TMHMM No significant hit