close all open/close all

CDS information : Adria_00360


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction36,752 / 38,047 / + [in whole cluster]
1,367 / 2,662 / + [in contig]
Location36752..38047 [in whole cluster]
1367..2662 [in contig]
TypeCDS
Length1,296 bp (431 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyl transferase
Gene
Gene (GenBank)dnrS
EC number
Keyword
  • daunosamine
Note
Note (GenBank)
Reference
ACC
PmId
[7592454] Cloning and characterization of the Streptomyces peucetius dnrQS genes encoding a daunosamine biosynthesis enzyme and a glycosyl transferase involved in daunorubicin biosynthesis. (J Bacteriol. , 1995)
Related Reference
ACC
Q2PZR4
NITE
Cosmo_00120
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
ACC
Q9L4U6
NITE
Acla_00210
PmId
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)
ACC
Q9ZGH7
NITE
Pikro_00090
PmId
[15161264] Characterization of the glycosyltransferase activity of desVII: analysis of and implications for the biosynthesis of macrolide antibiotics. (J Am Chem Soc. , 2004)
[15358425] New olivosyl derivatives of methymycin/pikromycin from an engineered strain of Streptomyces venezuelae. (FEMS Microbiol Lett. , 2004)
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[23770075] Combinatorial biosynthesis and antibacterial evaluation of glycosylated derivatives of 12-membered macrolide antibiotic YC-17. (J Biotechnol. , 2013)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyl transferase]
MKVLVTAFAMDAHFNGVVPLAWALRAAGHDVRVASQPALTDSITRAGLTAVPVGTDHQVQ
AAMGAMAPGVFALHLNPDYLENRPELLDLEFLEASTSMLTAAFYAQINNDSMIDEMVDFA
AWWRPDLVVWEPFTFGGAVAAQVTGAAQARLLWGPDLFLRVHDRFQQVLHEVPAERRDDA
LEEWLTWTLERHGAAFGPEVISGHWTIDQMPPSVRFATARPTVPMRFVPYNGPVPAVVPP
WLRADPGRPRVLLTQGITERSTGFTGLPRAGELLASIAELDAEVVATVKAEEREGLPPLP
GNVRVVDSLSLHVVLPSCAAVVHHGGAGTWATAALHGVPQLALAWQWDDVFRAGQLEKLG
AGIFLPPHGEGASAGRVRDRLAQVLAEPSFRQGAARIRAEMLRTPAPGAVVPTLEQLTAR
HRAPAGQGVRH
selected fasta
>putative glycosyltransferase [glycosyl transferase]
ATGAAGGTGCTCGTGACGGCGTTCGCCATGGACGCGCACTTCAATGGTGTGGTGCCGCTC
GCCTGGGCGCTGCGGGCGGCCGGGCACGACGTCCGGGTGGCGAGCCAGCCCGCTCTCACC
GACAGCATCACCCGCGCTGGACTCACGGCCGTACCGGTGGGTACGGACCACCAGGTGCAG
GCGGCGATGGGGGCCATGGCGCCCGGCGTGTTCGCGCTGCACCTGAACCCGGACTACCTG
GAGAACCGGCCGGAGCTGCTCGACCTGGAGTTCCTCGAAGCGTCCACGTCCATGCTGACG
GCGGCGTTCTACGCCCAGATCAACAACGACTCCATGATCGACGAGATGGTGGACTTCGCC
GCCTGGTGGCGTCCCGACCTGGTCGTCTGGGAGCCCTTCACTTTCGGCGGCGCGGTGGCG
GCCCAGGTGACCGGCGCGGCGCAGGCCCGCCTGCTGTGGGGCCCGGACCTCTTCCTGCGG
GTGCACGACCGGTTCCAGCAGGTGCTGCACGAGGTGCCGGCCGAGCGCCGGGACGACGCC
CTGGAGGAGTGGCTGACGTGGACGCTGGAGCGGCACGGTGCGGCCTTCGGGCCCGAGGTG
ATCAGCGGCCACTGGACGATCGACCAGATGCCGCCGAGCGTGCGGTTCGCCACGGCCCGC
CCGACGGTGCCGATGCGGTTCGTCCCGTACAACGGGCCGGTCCCGGCGGTGGTGCCGCCG
TGGCTGCGGGCGGATCCGGGGCGCCCGAGGGTCCTGCTCACCCAAGGCATCACGGAGCGC
TCGACGGGCTTCACCGGGCTGCCCCGGGCCGGTGAGCTGCTGGCCTCGATCGCGGAGCTG
GACGCCGAGGTGGTCGCCACGGTCAAGGCCGAGGAGCGCGAGGGCCTGCCGCCTCTGCCC
GGGAACGTGCGGGTGGTGGACAGCCTGTCCCTGCACGTCGTCCTGCCGAGCTGCGCGGCC
GTCGTGCACCACGGCGGCGCCGGCACCTGGGCGACGGCGGCGCTGCACGGGGTGCCTCAG
CTTGCCCTCGCCTGGCAGTGGGACGACGTCTTCCGGGCCGGGCAGCTGGAGAAGCTGGGC
GCGGGGATCTTCCTCCCGCCGCACGGCGAGGGCGCCTCGGCCGGCCGGGTCAGGGACAGG
CTGGCTCAGGTACTGGCCGAGCCGTCCTTCCGGCAGGGCGCGGCGCGGATCCGCGCGGAG
ATGCTGCGGACCCCGGCACCCGGTGCGGTGGTGCCGACGCTGGAACAGCTGACGGCCCGG
CACCGTGCTCCGGCCGGGCAGGGCGTCCGGCACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [4-129]  4.80000000000001e-13 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [207-304]  8.1e-32 PF06722
PF06722   DUF1205
SignalP
 [1-28]  0.62 Signal
Eukaryota   
 [1-23]  0.303 Signal
Bacteria, Gram-positive   
TMHMM No significant hit