close all open/close all
Adria_00360 Adria_00360   last last

CDS information : Adria_00370


close this sectionLocation

Organism
StrainATCC 29050 (=NBRC 100596)
Entry nameDoxorubicin
Contig
Start / Stop / Direction41,213 / 38,919 / - [in whole cluster]
991 / 3,285 / + [in contig]
Locationcomplement(38919..41213) [in whole cluster]
991..3285 [in contig]
TypeCDS
Length2,295 bp (764 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
ProductUvrA-like protein
Product (GenBank)daunorubicin resistance protein
Gene
Gene (GenBank)drrC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8655504] The Streptomyces peucetius drrC gene encodes a UvrA-like protein involved in daunorubicin resistance and production. (J Bacteriol. , 1996)
[9835035] The DrrC protein of Streptomyces peucetius, a UvrA-like protein, is a DNA-binding protein whose gene is induced by daunorubicin. (FEMS Microbiol Lett. , 1998)

close this sectionSequence

selected fasta
>UvrA-like protein [daunorubicin resistance protein]
MQQQAIQIIGARENNLKGISVEVPKHKVTVFTGVSGSGKSSLVFDTIAAESQRQLNETFT
AFVRNRLPKYGQPDVDDIANLSAAVIIDQKRIGGNARSTVGTITDIYALLRLLYSRVGKP
WIGYSNAFSFNDPSGMCPDCEGLGHRVQVDLDKLLDRSKSLNEGAIRHPAFNVGGWFWKL
YANSGLFDNDKKLRDYTESEWQAFLYGAQGSIALEWQGGKVNSKYEGLMDKFNRLYLRKE
PDEMSAKNRVALQQVVTRGPCDTCKGQRLSQRALGCRINGRNIAELASLEIADLMEAVKK
VDTSSVSTLTASLIERLQHLIELGLGYLSLNRETSTLSGGESQRIKMVRHLNSSLVDMVY
IFDEPTIGLHPSDVQRLSRLLMELAEKGNTVLVVEHDRDIIEVAEHVIDIGPGAGRHGGE
IVYQGDVRGLTEADTPTGRFLRRIIPIKERFRGPRGHLEVTGARIHNLKDISVRIPLGVL
TAVTGPAGSGKSTLIHDVLLRQHPSAVVIDQSAVTTNRRSNPATYTGIMDEIRRLFAREN
QVSPSLFSFNSEGACPTCQGHGIIYTDLAFMDPMITTCEVCAGMRFTDDVLRLTLRGQNI
HDVLSMSAAEAAEFFTEPKVAKTLRSINQVGLGYLQLGQPLNTLSGGECQRIKLATELGK
KGSVYVMDEPTTGLHMSDVDSLVHLVDGLVEKGDSVIVIEHNLDVVKHADWVVDLGPGGG
SEGGRVIFEGTPADLAEAEHSVTGRFLAASLAGAGSEADHRARR
selected fasta
>UvrA-like protein [daunorubicin resistance protein]
ATGCAGCAGCAGGCTATTCAGATCATCGGTGCCCGTGAGAACAACCTCAAGGGCATCTCC
GTGGAGGTGCCGAAACACAAGGTCACCGTGTTCACGGGGGTATCGGGATCGGGAAAGTCG
TCCTTGGTATTCGACACAATCGCGGCGGAATCCCAACGGCAGCTCAATGAGACGTTCACC
GCGTTCGTGCGCAATCGCCTGCCCAAATACGGTCAGCCCGACGTGGACGACATCGCGAAC
CTCTCCGCTGCGGTGATCATCGATCAGAAGCGGATCGGGGGGAACGCGCGGTCCACCGTC
GGGACGATCACCGACATCTACGCCTTGCTCCGGCTGCTCTATTCCCGGGTGGGCAAGCCC
TGGATTGGTTATTCGAACGCCTTCTCGTTCAACGACCCCTCGGGAATGTGCCCCGATTGC
GAGGGCCTCGGCCACCGGGTGCAGGTCGACCTCGACAAGCTGCTCGACAGGTCCAAGTCC
CTCAATGAGGGCGCCATCCGGCATCCCGCCTTCAATGTTGGTGGCTGGTTCTGGAAGCTG
TACGCCAATTCCGGCCTCTTCGACAACGACAAGAAGCTCCGCGACTACACCGAGAGCGAG
TGGCAGGCGTTCCTGTACGGGGCCCAGGGGTCGATCGCTCTGGAGTGGCAGGGTGGCAAG
GTCAACTCGAAGTACGAAGGGCTGATGGACAAGTTCAACCGGCTCTACCTGCGCAAGGAG
CCGGACGAGATGAGCGCCAAGAACCGGGTGGCGCTGCAACAGGTCGTCACCCGGGGGCCC
TGCGACACCTGCAAGGGGCAACGGCTCAGCCAGCGGGCGCTCGGCTGCCGCATCAACGGC
CGGAACATCGCCGAACTCGCCTCCCTGGAGATCGCCGACCTGATGGAGGCGGTCAAGAAG
GTCGACACGTCCTCCGTCTCCACCCTGACGGCCAGTCTGATCGAGCGGCTCCAGCACCTC
ATCGAACTGGGGCTGGGATACCTCAGCCTCAACCGTGAGACCTCCACGCTCTCCGGCGGC
GAGTCGCAGCGCATCAAGATGGTGCGTCACCTGAACAGTTCGCTCGTCGACATGGTGTAC
ATCTTCGACGAGCCCACGATCGGCCTGCACCCCAGCGACGTCCAGCGGCTCAGCCGGCTC
CTGATGGAACTGGCCGAGAAGGGCAACACCGTGCTGGTGGTCGAGCACGACCGCGACATC
ATCGAGGTGGCCGAGCACGTCATCGACATCGGGCCCGGGGCCGGGCGGCACGGAGGCGAG
ATCGTCTACCAGGGCGACGTCCGGGGCCTCACCGAGGCGGACACGCCGACCGGACGGTTC
CTCCGCAGGATCATCCCGATCAAGGAGCGATTCCGCGGGCCCAGGGGACACCTGGAGGTG
ACGGGAGCCCGGATCCACAACCTCAAGGACATCAGCGTACGGATTCCGCTCGGCGTACTG
ACCGCCGTCACCGGACCGGCTGGCTCCGGCAAGAGCACGCTCATCCACGACGTACTGCTG
CGGCAGCACCCCTCGGCGGTCGTCATCGACCAGTCCGCGGTCACCACCAACCGGCGTTCG
AACCCGGCGACCTACACCGGCATCATGGACGAGATCCGCAGGCTGTTCGCCCGCGAGAAC
CAGGTCAGCCCCTCACTGTTCAGCTTCAACTCCGAGGGCGCCTGCCCCACCTGCCAGGGA
CACGGCATCATCTACACCGACCTCGCCTTCATGGATCCGATGATCACGACCTGCGAGGTC
TGCGCGGGGATGCGTTTCACCGATGACGTCCTGCGCCTGACCCTGCGCGGGCAGAACATC
CACGACGTGCTGTCGATGAGCGCCGCTGAGGCGGCCGAGTTCTTCACCGAACCCAAGGTT
GCCAAGACCCTCCGTTCCATCAACCAGGTCGGCCTCGGCTATCTCCAGCTCGGGCAGCCG
CTCAACACCCTCTCCGGCGGCGAGTGCCAGCGCATCAAGCTCGCCACGGAGCTTGGGAAG
AAGGGCAGCGTCTACGTCATGGACGAGCCCACCACCGGACTCCACATGTCCGACGTCGAC
AGCCTCGTACACCTGGTCGACGGCCTCGTCGAGAAGGGGGACTCGGTCATCGTCATCGAG
CACAATCTCGACGTCGTCAAGCATGCGGACTGGGTCGTCGACCTCGGCCCCGGGGGCGGC
AGCGAGGGCGGCCGGGTGATCTTTGAGGGCACCCCCGCTGACCTGGCGGAGGCCGAGCAC
TCCGTCACTGGGCGGTTCCTCGCCGCGTCCCTGGCGGGCGCCGGTTCCGAGGCCGACCAC
CGGGCCCGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [316-366]  5.60000000000001e-05 PF00005 [619-672]  2.3e-09 PF00005
PF00005   ABC_tran
 [1-437]  PS50893 [445-742]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [25-414]  0.00220000021756082 SM00382 [477-753]  0.000129999995835436 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [644-658]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit
Adria_00360 Adria_00360   last last