close all open/close all
first first   Alip_00020 Alip_00020

CDS information : Alip_00010


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction675 / 1 / - [in whole cluster]
675 / 1 / - [in contig]
Locationcomplement(1..675) [in whole cluster]
complement(1..675) [in contig]
TypeCDS
Length675 bp (224 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttwo-component system response regulator
Product (GenBank)LipReg1
Gene
Gene (GenBank)lipReg1
EC number
Keyword
Note
Note (GenBank)
  • putative two-component system response regulator
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
[19585113] Characterization and analysis of the regulatory network involved in control of lipomycin biosynthesis in Streptomyces aureofaciens Tu117. (Appl Microbiol Biotechnol. , 2010)
Family/Domain
FD
IPR001789, IPR000792

close this sectionSequence

selected fasta
>two-component system response regulator [LipReg1]
MTAIRLLLVDDDPLVRAGLSLMLGGADDVEIVGEAADGDEVGALVDRTRPDVVLMDIRMP
VVDGLTATERLRGRADAPQVVVLTTFHADEQVLRALRAGAAGFVLKDTPPAEILDAVRRV
AAGDPVLSPAVTRRLMEQAAGAAPDARRTRARARVDTLNDREREVAVAVGRGMANADIAT
DLFMSVATVKAHVSRILAKLDLNNRVQIALLVHDAGLLDEHADD
selected fasta
>two-component system response regulator [LipReg1]
ATGACCGCGATCAGACTGCTCCTCGTCGACGACGACCCGCTCGTGCGGGCCGGACTGTCC
CTCATGCTGGGCGGCGCGGACGACGTGGAGATCGTCGGTGAGGCCGCCGACGGCGACGAG
GTGGGGGCGCTCGTCGACCGCACCCGCCCGGACGTCGTCCTCATGGACATCCGGATGCCG
GTGGTGGACGGCCTCACGGCGACCGAGCGGCTGCGGGGCCGGGCGGACGCGCCCCAGGTC
GTCGTGCTCACCACCTTCCACGCGGACGAGCAGGTGCTGCGCGCCCTGCGGGCCGGTGCC
GCCGGCTTCGTCCTCAAGGACACCCCTCCCGCCGAGATCCTCGACGCGGTGCGCAGGGTC
GCCGCCGGAGACCCCGTCCTGTCGCCCGCCGTCACCCGGCGACTGATGGAGCAGGCGGCC
GGCGCCGCCCCCGACGCGAGGCGCACACGCGCGCGTGCCCGCGTGGACACCCTCAACGAC
CGCGAGCGCGAGGTCGCCGTCGCGGTCGGCCGCGGCATGGCCAACGCCGACATCGCGACC
GACCTCTTCATGAGCGTCGCCACGGTCAAGGCCCACGTCTCCCGCATCCTGGCCAAGCTC
GACCTCAACAACCGGGTCCAGATCGCCCTGCTGGTCCACGACGCCGGCCTGCTGGACGAG
CACGCCGACGACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [156-211]  4.40000000000001e-14 PF00196
PF00196   GerE
 [155-212]  2.49999811956465e-19 SM00421
SM00421   HTH_LUXR
 [158-172]  2.89999717862184e-10 PR00038 [172-188]  2.89999717862184e-10 PR00038 [188-200]  2.89999717862184e-10 PR00038
PR00038   HTHLUXR
 [151-216]  PS50043
PS50043   HTH_LUXR_2
 [172-199]  PS00622
PS00622   HTH_LUXR_1
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [5-121]  PS50110
PS50110   RESPONSE_REGULATORY
 [4-117]  1.89999859865865e-32 SM00448
SM00448   REC
 [6-118]  1.2e-27 PF00072
PF00072   Response_reg
IPR011006 CheY-like superfamily (Domain)
 [1-134]  5.59999989417023e-32 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [125-219]  4.40000000000001e-26 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [136-222]  4.40000933643892e-19 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-17]  0.314 Signal
Eukaryota   
TMHMM No significant hit
first first   Alip_00020 Alip_00020