close all open/close all

CDS information : Alip_00020


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction2,019 / 760 / - [in whole cluster]
2,019 / 760 / - [in contig]
Locationcomplement(760..2019) [in whole cluster]
complement(760..2019) [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Producttwo-component system histidine kinase
Product (GenBank)LipReg2
Gene
Gene (GenBank)lipReg2
EC number
Keyword
Note
Note (GenBank)
  • putative two-component system sensor kinase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
[19585113] Characterization and analysis of the regulatory network involved in control of lipomycin biosynthesis in Streptomyces aureofaciens Tu117. (Appl Microbiol Biotechnol. , 2010)
Family/Domain
FD
IPR011712

close this sectionSequence

selected fasta
>two-component system histidine kinase [LipReg2]
MSTVNSDKQATVPPAFAKRRWVLPAALVEDLYPEPRRPGGRPRRTARDWVVDFACFLLAV
AIGLLAADALDQEPDLSPAMAVADQLIGALACAAVWLRRRWPVGLAVAMVPVSLVSATAG
GAVLAALFTLAVHRPFRYVAWIGGTSLAVTPLYYWMRPEPGLPFLASLAIAFLLAVTVLG
WGMLVRSKRQLLLSLRDRARHAEAEARLRAEQAQRLAREAIAREMHDVLAHRLTLLSVHA
GALEFRPDAPREEVARAAGVIRESAHEALQDLRQIIGVLRAADSDDAGRPQPTLAALDAL
VAESRAAGMRVTLADRVPDPGAVPAAVGRTAYRIAQEALTNARKHAPGTEVTVSVTGAPG
AGLALSVRNAPPRGEVPHVPGSGQGLIGLTERATLAGGTLEHGPTPGGGFEVRARLPWG
selected fasta
>two-component system histidine kinase [LipReg2]
TTGTCGACTGTGAACAGTGACAAGCAGGCCACGGTGCCCCCGGCGTTCGCCAAGCGGCGC
TGGGTCCTGCCGGCGGCGCTGGTGGAGGACCTCTACCCGGAACCCCGGCGGCCCGGCGGC
CGGCCCCGGCGCACCGCACGCGACTGGGTCGTCGACTTCGCCTGCTTCCTGCTCGCGGTC
GCCATCGGCCTGCTGGCCGCCGACGCGCTGGACCAGGAACCGGACCTCTCACCCGCCATG
GCCGTCGCGGACCAGCTGATCGGCGCCCTCGCCTGCGCCGCCGTCTGGCTCCGGCGGCGC
TGGCCGGTCGGGCTGGCCGTGGCCATGGTGCCCGTCTCCCTGGTCTCGGCCACCGCGGGC
GGCGCCGTCCTCGCCGCCCTGTTCACGCTCGCCGTGCACCGGCCCTTCCGGTACGTGGCC
TGGATCGGCGGCACGAGTCTCGCCGTGACGCCCCTGTACTACTGGATGCGCCCGGAGCCC
GGGCTGCCCTTCCTCGCCTCCCTCGCCATCGCCTTCCTGCTCGCGGTCACTGTGCTCGGC
TGGGGCATGCTGGTCCGCTCCAAGCGCCAGCTCCTGCTCAGCCTGCGCGACCGCGCCCGG
CACGCCGAGGCCGAGGCGCGGCTGCGGGCCGAACAGGCGCAGCGGCTGGCCCGGGAGGCC
ATCGCCCGCGAGATGCACGACGTCCTCGCCCACCGGCTGACGCTGCTCAGCGTGCACGCG
GGCGCCCTGGAGTTCCGGCCCGACGCACCCCGCGAGGAGGTCGCGCGGGCGGCGGGCGTC
ATCCGGGAGAGCGCGCACGAGGCCCTCCAGGATCTGCGGCAGATCATCGGCGTCCTGCGG
GCGGCGGACTCCGACGACGCCGGCCGCCCCCAGCCGACGCTCGCGGCGCTCGACGCGCTG
GTCGCCGAGTCCCGTGCGGCCGGCATGAGGGTCACCCTCGCGGACCGCGTGCCCGACCCC
GGCGCCGTCCCCGCCGCCGTCGGCCGCACCGCGTACCGCATCGCCCAGGAGGCGCTCACG
AACGCGCGCAAGCACGCCCCCGGCACCGAGGTCACCGTCTCGGTCACCGGGGCGCCGGGC
GCCGGACTCGCCCTGTCGGTGCGCAACGCCCCGCCCCGGGGCGAGGTGCCCCACGTGCCC
GGTTCCGGCCAGGGCCTGATCGGGCTGACCGAGCGGGCCACGCTGGCGGGCGGCACCCTG
GAGCACGGCCCGACCCCCGGCGGCGGCTTCGAGGTGCGGGCGAGGCTGCCGTGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [326-419]  0.00429999934584839 SM00387
SM00387   HATPase_c
 [297-418]  2.79999889404114e-11 SSF55874
SSF55874   ATP_bd_ATPase
 [330-417]  0.00014 PF02518
PF02518   HATPase_c
IPR011712 Signal transduction histidine kinase, subgroup 3, dimerisation and phosphoacceptor domain (Domain)
 [218-282]  3e-14 PF07730
PF07730   HisKA_3
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-25]  0.117 Signal
Bacteria, Gram-negative   
TMHMM
 [49-66]  Transmembrane (i-o) [76-98]  Transmembrane (o-i) [105-127]  Transmembrane (i-o) [137-156]  Transmembrane (o-i) [163-185]  Transmembrane (i-o)
Transmembrane 5