close all open/close all

CDS information : Alip_00030


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction2,569 / 2,958 / + [in whole cluster]
2,569 / 2,958 / + [in contig]
Location2569..2958 [in whole cluster]
2569..2958 [in contig]
TypeCDS
Length390 bp (129 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative endoribonuclease
Product (GenBank)LipX1
Gene
Gene (GenBank)lipX1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
[19585113] Characterization and analysis of the regulatory network involved in control of lipomycin biosynthesis in Streptomyces aureofaciens Tu117. (Appl Microbiol Biotechnol. , 2010)
Related Reference
ACC
P30289
PmId
[9367812] Purification of ribonucleases Sa, Sa2, and Sa3 after expression in Escherichia coli. (Protein Expr Purif. , 1997)
[12228255] X-ray structure of two crystalline forms of a streptomycete ribonuclease with cytotoxic activity. (J Biol Chem. , 2002)
Family/Domain
FD
IPR000026

close this sectionSequence

selected fasta
>putative endoribonuclease [LipX1]
MRFPPRITRIGTAAAVLSALLVGGTVATASPAAAAVGSICYGDLPSQAYDTLELIEQGGP
FPYSQDGTVFQNREGILPSQSSGYYHEYTVITPGSSTRGARRIVTGEENQEDYYTADHYE
SFDLVDYGC
selected fasta
>putative endoribonuclease [LipX1]
ATGAGATTCCCCCCACGAATCACTCGCATCGGCACCGCGGCCGCCGTCCTGTCCGCCCTC
CTCGTCGGAGGCACCGTCGCCACCGCCTCCCCGGCGGCCGCCGCGGTGGGCAGCATCTGC
TACGGCGACCTGCCCTCCCAGGCGTACGACACCCTCGAACTGATCGAGCAGGGCGGTCCC
TTCCCGTACTCGCAGGACGGCACCGTCTTCCAGAACCGGGAAGGCATCCTGCCGAGCCAG
TCCTCCGGCTACTACCACGAGTACACGGTGATCACGCCGGGCTCCTCCACGCGCGGTGCT
CGGCGCATCGTCACCGGCGAGGAGAACCAGGAGGACTACTACACGGCCGACCACTACGAG
TCCTTCGACCTGGTCGACTACGGCTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000026 Guanine-specific ribonuclease N1/T1 (Family)
 [44-124]  2.5e-25 PF00545
PF00545   Ribonuclease
IPR016191 Ribonuclease/ribotoxin (Domain)
 [33-129]  6.60002751141562e-41 SSF53933
SSF53933   Ribonuclease/ribotoxin
 [36-126]  2.50000000000001e-42 G3DSA:3.10.450.30
G3DSA:3.10.450.30   Ribonuclease/ribotoxin
SignalP
 [1-29]  0.99 Signal
Eukaryota   
 [1-34]  1 Signal
Bacteria, Gram-negative   
 [1-34]  1 Signal
Bacteria, Gram-positive   
TMHMM
 [13-35]  Transmembrane (i-o)
Transmembrane 1