close all open/close all

CDS information : Alip_00040


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction5,480 / 3,180 / - [in whole cluster]
5,480 / 3,180 / - [in contig]
Locationcomplement(3180..5480) [in whole cluster]
complement(3180..5480) [in contig]
TypeCDS
Length2,301 bp (766 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)LipEx1
Gene
Gene (GenBank)lipEx1
EC number
Keyword
Note
Note (GenBank)
  • putative efflux protein
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
P42670
PmId
[7916693] The pur8 gene from the pur cluster of Streptomyces alboniger encodes a highly hydrophobic polypeptide which confers resistance to puromycin. (Eur J Biochem. , 1993)

close this sectionSequence

selected fasta
>putative drug resistance transporter [LipEx1]
MSAGAATADEQAAAERNHRNRWYVLAVIATAQLMVMLDGTIVQIALPSVQQSLHMSDTNR
QWMVTAYALAFGGLLLIGGRLADRFGRGRTFLVGLVGFAVVSALGGAAPNTETLITARAL
QGVFAAILSPATVSLLTTTFTSTKERAKAFGLFSGVVGSGAAIGLIVGGVLTEYAGWRWC
LYVNVPIAVAVTALGIATLPRDRGHRDISLDAIGAVLGCLGPLALVYALSEAPDRGWDSP
LVAGLLAASVVLIAAFLLSQTRIRQPLLPLRVVAERTRAGSFLGAALLNFGMMGISLFAT
YHLQIVMHYKPLKAGFAFLPMVGAVMVTATQVVARVMGRVPTRWLVGPGLAFTAAGVWMF
TTLSEDSSYLFGVLPAWLLLGVGMGLSYSPTTHASLAGVAERDSGAVSAFQTTARQIGGA
IGLALSNTLAADAAASYYADHEGRGAQGELLVKSIVHGSAAAAWWVSGILLVGTVACTIM
INADPRKVRQGAADADADGAPGTDAILICGRVVWAEDVPVSEAALTLVTHDGREVARATA
DGDGAYALRAPGDGPYILIARSCSHRSTATPLALTAGASAIEHTVTFQDEGVVVGIAQDE
ADGMPLKGASVILTDVNGRLVRSLSTDEDGSFVIDGLAYSPYVLVVHHDGYRPAAIDIQI
GEARQITVTVELSSHTRLGSLSGVVSDSERTPVNDVRLTLTDGSGTGLTATTKEDGSFRF
ADLPVGSYILITAGHPPTVSRLTISEAINQHNIHLDRREDAPSRES
selected fasta
>putative drug resistance transporter [LipEx1]
ATGAGCGCAGGCGCTGCGACGGCGGACGAGCAGGCGGCCGCCGAGCGCAACCACCGCAAC
CGCTGGTACGTGCTCGCCGTCATCGCCACCGCCCAGTTGATGGTGATGCTCGACGGCACG
ATCGTCCAGATCGCGCTGCCCTCCGTCCAGCAGTCGCTCCATATGTCCGACACCAACCGG
CAGTGGATGGTCACCGCGTACGCGCTGGCCTTCGGAGGACTACTCCTGATCGGCGGCCGG
CTCGCCGACCGTTTCGGCCGCGGCCGGACCTTTCTCGTGGGCCTGGTCGGCTTCGCCGTG
GTCTCCGCGCTCGGCGGTGCCGCACCCAACACCGAAACGCTCATCACCGCCCGGGCGCTG
CAAGGTGTCTTCGCCGCCATCCTCTCGCCGGCCACGGTGTCCTTGCTGACCACCACCTTC
ACCAGCACCAAGGAGCGGGCCAAGGCTTTCGGCCTCTTCAGCGGCGTCGTCGGCAGCGGA
GCCGCCATCGGACTGATCGTCGGCGGTGTGCTCACCGAGTACGCGGGCTGGCGCTGGTGT
CTTTATGTGAACGTGCCGATCGCCGTCGCCGTGACCGCCCTGGGCATCGCCACCCTGCCA
CGCGACCGGGGTCACCGTGACATCAGCCTCGACGCGATCGGTGCGGTCCTCGGCTGTCTG
GGCCCGCTCGCCCTTGTCTACGCACTGTCCGAGGCGCCGGACCGCGGCTGGGACTCCCCC
CTGGTGGCCGGGCTGTTGGCCGCGTCCGTCGTCCTGATCGCCGCGTTCCTGCTCTCCCAG
ACCCGCATCCGGCAGCCGCTGCTGCCGCTGCGCGTGGTCGCCGAACGCACCCGTGCGGGG
TCCTTCCTCGGGGCCGCGTTGCTCAACTTCGGCATGATGGGCATCTCGCTGTTCGCCACG
TACCACCTGCAGATCGTCATGCACTACAAGCCGCTCAAAGCGGGATTCGCGTTCCTGCCG
ATGGTCGGTGCGGTCATGGTGACCGCGACACAGGTCGTCGCGCGCGTCATGGGGCGGGTT
CCGACGCGTTGGCTGGTCGGACCAGGTCTCGCCTTCACCGCGGCCGGAGTGTGGATGTTC
ACCACGCTCTCCGAGGACAGTTCCTACCTCTTCGGGGTGCTGCCGGCTTGGCTCCTGCTG
GGCGTCGGCATGGGCCTGAGCTATTCCCCCACCACACACGCCTCCCTGGCAGGGGTGGCC
GAACGCGACTCGGGCGCGGTGTCCGCCTTCCAGACGACTGCCCGGCAGATCGGCGGTGCC
ATCGGCCTCGCGCTGAGCAACACCCTTGCAGCCGACGCGGCGGCCTCCTACTACGCCGAC
CACGAGGGCCGGGGTGCCCAGGGTGAACTCCTCGTCAAGTCCATCGTGCACGGCAGCGCG
GCCGCCGCGTGGTGGGTCAGCGGCATTCTGCTCGTCGGCACGGTCGCCTGCACGATCATG
ATCAACGCTGATCCGCGCAAGGTGCGGCAGGGCGCCGCGGACGCCGACGCCGACGGTGCG
CCTGGCACCGACGCCATCCTGATCTGTGGCCGTGTCGTGTGGGCCGAGGACGTTCCGGTC
TCCGAGGCGGCGCTCACCCTGGTCACCCACGACGGCCGCGAGGTCGCGCGGGCGACGGCT
GACGGCGACGGCGCCTACGCGCTGCGTGCCCCCGGAGACGGGCCGTACATTCTCATCGCC
CGCTCTTGTTCCCACCGTTCGACCGCTACGCCGCTCGCCCTCACCGCGGGCGCCTCGGCC
ATCGAGCACACGGTCACCTTCCAGGACGAAGGTGTGGTCGTCGGCATCGCGCAGGACGAG
GCGGACGGGATGCCACTGAAGGGCGCGTCCGTCATACTGACCGACGTGAACGGCCGCCTC
GTCCGTTCCCTGTCGACTGATGAAGACGGTTCGTTCGTCATCGACGGGCTCGCGTACAGC
CCCTACGTCCTCGTGGTTCACCACGACGGCTACCGGCCGGCGGCCATCGACATCCAGATC
GGCGAGGCACGGCAGATCACGGTGACGGTGGAACTCTCCTCGCACACCCGTCTCGGCAGC
CTGAGCGGGGTGGTCAGCGACAGTGAGCGCACCCCTGTGAACGACGTGCGACTCACTCTC
ACGGACGGCTCCGGCACCGGGCTGACCGCCACGACCAAGGAGGACGGCAGCTTCCGGTTC
GCGGACCTACCGGTCGGCAGTTACATCCTGATCACCGCGGGCCATCCGCCGACGGTGAGC
CGACTCACCATCTCCGAGGCGATCAACCAGCACAACATCCATCTGGACCGCCGCGAAGAC
GCTCCCTCCCGCGAATCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [26-438]  2.70000000000002e-71 TIGR00711
TIGR00711   Efflux_EmrB
IPR008970 Collagen-binding surface protein Cna, B-type domain (Domain)
 [507-577]  9.30000048475975e-07 SSF49478 [680-755]  1.69999922284049e-10 SSF49478
SSF49478   Cna_B_unit
IPR011701 Major facilitator superfamily (Family)
 [29-422]  2.4e-49 PF07690
PF07690   MFS_1
IPR013783 Immunoglobulin-like fold (Domain)
 [514-563]  4.2e-28 G3DSA:2.60.40.10 [682-740]  4.2e-28 G3DSA:2.60.40.10
G3DSA:2.60.40.10   Ig-like_fold
IPR013784 Carbohydrate-binding-like fold (Domain)
 [584-670]  5.69999708783953e-14 SSF49452
SSF49452   CBD_4
IPR014766 Carboxypeptidase, regulatory domain (Domain)
 [595-675]  5.09999999999998e-27 G3DSA:2.60.40.1120
G3DSA:2.60.40.1120   CarboxyPept_regulatory
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-498]  2.80000504261099e-67 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [24-486]  PS50850
PS50850   MFS
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [20-42]  Transmembrane (i-o) [62-79]  Transmembrane (o-i) [91-109]  Transmembrane (i-o) [114-136]  Transmembrane (o-i) [149-171]  Transmembrane (i-o) [175-197]  Transmembrane (o-i) [210-229]  Transmembrane (i-o) [239-258]  Transmembrane (o-i) [279-301]  Transmembrane (i-o) [316-338]  Transmembrane (o-i) [345-362]  Transmembrane (i-o) [367-389]  Transmembrane (o-i) [461-483]  Transmembrane (i-o)
Transmembrane 13