close all open/close all

CDS information : Alip_00050


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction5,947 / 5,477 / - [in whole cluster]
5,947 / 5,477 / - [in contig]
Locationcomplement(5477..5947) [in whole cluster]
complement(5477..5947) [in contig]
TypeCDS
Length471 bp (156 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductMarR family transcriptional repressor
Product (GenBank)LipReg3
Gene
Gene (GenBank)lipReg3
EC number
Keyword
Note
Note (GenBank)
  • putative MarR-family transcriptional regulator
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
[19585113] Characterization and analysis of the regulatory network involved in control of lipomycin biosynthesis in Streptomyces aureofaciens Tu117. (Appl Microbiol Biotechnol. , 2010)
Family/Domain
FD
IPR000835

close this sectionSequence

selected fasta
>MarR family transcriptional repressor [LipReg3]
MEVSVARDPEVTASELVAALTETVSPLLRHAGTVFANNQVPFSQASLLTDLYERGAPQRM
STLAQTFDVAPRTVTALVDGLERRGLVQRAPDPDDRRAVLVGVTDKGNALMQEIEWGRQA
LADELVNGLTRDERVEFARLLNKLRPAPKSEKGSQA
selected fasta
>MarR family transcriptional repressor [LipReg3]
ATGGAGGTGTCCGTGGCTCGAGATCCTGAGGTCACGGCTTCCGAGCTCGTTGCGGCTCTG
ACGGAGACGGTGTCTCCGCTTCTGCGCCACGCCGGGACCGTGTTCGCCAACAATCAGGTC
CCCTTCTCCCAGGCCAGCCTGCTGACCGACCTGTACGAGCGGGGAGCCCCCCAACGCATG
AGCACGCTGGCCCAGACGTTCGACGTGGCCCCGCGCACCGTCACCGCCCTCGTCGACGGA
CTCGAGCGCCGCGGCCTCGTCCAGCGGGCCCCGGACCCGGATGATCGTCGCGCCGTTCTG
GTCGGCGTCACCGACAAGGGCAACGCGCTGATGCAGGAGATCGAGTGGGGCAGGCAGGCC
CTCGCCGACGAACTCGTCAACGGTCTGACCCGCGACGAACGCGTGGAGTTCGCGCGCCTG
CTCAACAAGCTCCGCCCGGCGCCCAAGAGCGAGAAGGGGTCCCAGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [13-146]  PS50995
PS50995   HTH_MARR_2
 [33-134]  7.99999145876753e-20 SM00347
SM00347   HTH_MARR
 [43-99]  7.59999999999999e-13 PF01047
PF01047   MarR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [8-145]  7.7e-32 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-36]  0.246 Signal
Bacteria, Gram-positive   
 [1-36]  0.191 Signal
Bacteria, Gram-negative   
TMHMM No significant hit