close all open/close all

CDS information : Alip_00060


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction6,203 / 8,713 / + [in whole cluster]
6,203 / 8,713 / + [in contig]
Location6203..8713 [in whole cluster]
6203..8713 [in contig]
TypeCDS
Length2,511 bp (836 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)LipReg4
Gene
Gene (GenBank)lipReg4
EC number
Keyword
Note
  • This ORF product lacks the Transcription regulator LuxR, C-terminal domain (IPR000792).
Note (GenBank)
  • putative LuxR-family transcriptional activator
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
[19585113] Characterization and analysis of the regulatory network involved in control of lipomycin biosynthesis in Streptomyces aureofaciens Tu117. (Appl Microbiol Biotechnol. , 2010)

close this sectionSequence

selected fasta
>transcriptional activator [LipReg4]
MTQLKRRGLFSLDLLIERKDEISALRGLISDGRAGNGRITVVSGATGSGKTALLQQAAEC
AVEQGSVAVNVTCSPLERDVPLAVVRQLFDALPLGPQPARQVADMLAEGVQAGLGEIVTT
ITPAHARVAEALWGLLVAFSERIPVVVLIDDVRNSDALSLVYLLYFIRRVRPTCIAMVLS
DTEDPQPRFPLFRAEIMRLPELSHIRTAALSPTGVTELLAGRVRADKAGLLGAEFHNVSG
GSPLLLKSLLRDLADSASQPPEQCAPVVGEHFAQAVVSCLRRSGPTMLVVAQWVALLGES
TCKELLAECLGTSPESAHRLLRMLDTIGVTRAGRFRHPAARVAVMDGISEQNRAEMKFRV
ARMLYDTGAPATQVAGHLLGQAGQQAGLCTEQAAWAVSVLREAADRALTGNRVEQAIAWL
RQAHRLCTDKAERGAVLFHLARIQWRHSPTAALRCLDQVTKPFVHERFGTPYTLLLIRYL
LRSGRHQEAQKILHRLHRDADSLPDEVCAELRLLEMWLAVSFPAVAEHFPYDHSLVVRRS
GPVTGRDELQWQAARLLVGVLGGGVDGGFISEVEQALRLYQVAEATLEPLVMGLSALIFA
DRLAGAGSWCASLMDDVETLDAPAWRAALSALRAEIAVRQGDLKGAVRLAGQALDDIDAE
GWGVEIGVPLSTMVLAHVAMGRTEEANALLQLPAADPMHESRYGLQYRYARAHHHLAADR
PHAALRDFLDCGTLMRRWNLDAPGLALWRVGAAEALLLLGEQARAKSLMDEQWALLAGKR
TTRSAGMALRVCAAVTRPDRRPALLRQSAEILQGCGDRYVTGQDDGGPRPRARGPR
selected fasta
>transcriptional activator [LipReg4]
GTGACGCAACTGAAACGACGGGGGTTGTTTTCATTGGATTTGCTCATCGAGAGGAAGGAT
GAGATATCTGCCCTCCGCGGGCTGATATCAGACGGGAGAGCCGGAAACGGCAGAATCACC
GTCGTCAGTGGTGCGACGGGCAGCGGCAAGACCGCCCTGCTGCAACAAGCGGCCGAGTGC
GCGGTCGAACAGGGTTCGGTCGCCGTCAACGTCACCTGCTCGCCACTGGAGCGGGATGTG
CCGCTGGCTGTGGTGCGTCAGCTCTTCGACGCCCTTCCGCTCGGCCCCCAACCTGCCAGG
CAGGTCGCCGACATGCTGGCAGAAGGCGTGCAGGCGGGCCTGGGTGAGATCGTCACGACC
ATCACGCCGGCGCACGCCAGGGTCGCCGAGGCGCTGTGGGGCCTCTTGGTCGCCTTCTCC
GAACGCATCCCCGTCGTCGTCCTCATCGACGACGTACGGAATTCCGATGCGCTTTCGCTG
GTGTACTTGCTTTATTTCATTCGGCGGGTGCGCCCGACATGCATAGCCATGGTGCTGTCG
GACACAGAGGACCCGCAGCCGCGCTTCCCCCTCTTCCGGGCTGAAATCATGCGCCTCCCG
GAGCTGAGTCATATTCGCACAGCGGCGCTCAGTCCGACGGGTGTCACCGAATTGCTGGCG
GGCCGCGTGAGGGCGGATAAAGCCGGTCTGCTCGGAGCGGAATTCCATAATGTCAGCGGT
GGAAGTCCATTGCTGCTGAAATCTTTGCTGCGCGATCTGGCTGACTCGGCGTCCCAGCCC
CCGGAGCAGTGCGCACCGGTGGTCGGGGAGCACTTTGCGCAGGCCGTGGTCTCCTGCCTG
CGCCGCTCGGGACCGACGATGCTGGTAGTCGCGCAGTGGGTGGCGCTCCTCGGCGAGAGC
ACCTGCAAGGAACTGTTGGCGGAGTGTCTCGGCACCAGCCCGGAGTCCGCCCACCGGTTA
CTGCGAATGCTCGACACCATCGGTGTGACCCGAGCAGGACGATTCCGCCACCCTGCGGCC
AGAGTCGCGGTCATGGACGGCATCTCGGAGCAGAACCGTGCGGAAATGAAGTTCCGCGTG
GCCCGCATGCTCTACGACACGGGGGCACCCGCCACCCAGGTGGCCGGTCACCTCCTCGGC
CAGGCGGGGCAGCAGGCCGGGCTGTGCACCGAGCAGGCGGCATGGGCGGTCTCGGTGCTC
CGGGAAGCAGCCGACCGGGCTCTCACGGGCAATCGGGTCGAGCAGGCCATCGCCTGGCTG
CGGCAGGCCCACCGGCTCTGCACCGACAAGGCGGAGCGGGGCGCCGTCCTCTTCCACCTG
GCCCGCATCCAGTGGCGGCACAGTCCGACGGCTGCCCTGCGTTGCCTCGACCAGGTGACC
AAGCCGTTCGTGCACGAGCGGTTCGGGACGCCGTACACCCTGTTGCTCATCCGCTATCTG
CTGCGCAGCGGACGGCACCAGGAGGCGCAGAAGATCCTGCACCGCCTGCACCGCGACGCG
GACTCGCTCCCCGACGAGGTGTGCGCGGAACTCCGGCTGCTGGAGATGTGGTTGGCGGTC
TCCTTCCCCGCGGTGGCCGAGCACTTCCCCTACGACCACAGTCTGGTGGTACGACGCAGC
GGTCCGGTCACCGGACGGGACGAACTGCAATGGCAGGCCGCCAGACTGCTCGTCGGAGTG
CTGGGCGGTGGCGTGGACGGCGGATTCATCAGCGAGGTGGAGCAGGCCCTGCGTCTGTAC
CAAGTGGCCGAGGCCACCCTCGAACCGCTGGTGATGGGGCTGTCCGCGCTGATCTTCGCG
GACCGCCTCGCCGGCGCCGGTTCATGGTGTGCCTCGCTGATGGACGACGTCGAGACTCTC
GACGCACCCGCCTGGCGCGCCGCCCTGTCGGCGCTACGCGCGGAGATCGCGGTGCGCCAG
GGCGACCTCAAGGGCGCCGTCCGGCTCGCCGGGCAGGCGCTCGACGACATCGATGCGGAA
GGATGGGGGGTGGAGATCGGCGTCCCCCTCTCCACCATGGTGCTCGCCCACGTGGCGATG
GGGCGGACCGAGGAGGCCAACGCCCTGCTCCAACTGCCGGCGGCCGATCCCATGCACGAG
AGCCGTTACGGCCTGCAGTACCGCTACGCGCGTGCCCATCACCATCTCGCCGCCGACCGC
CCCCACGCCGCCCTGCGGGACTTCCTCGACTGCGGCACCCTGATGCGGCGGTGGAACCTC
GACGCTCCGGGCCTCGCCCTGTGGCGGGTGGGAGCAGCCGAGGCTCTGCTGCTCCTGGGG
GAACAAGCGCGAGCCAAGTCCCTGATGGACGAGCAGTGGGCACTGCTGGCCGGCAAACGC
ACCACCCGCAGTGCCGGCATGGCCCTGCGGGTGTGTGCCGCGGTCACCCGGCCGGACCGG
CGGCCGGCGCTGCTGAGACAGTCCGCGGAGATCCTTCAGGGCTGCGGCGACCGCTACGTA
ACTGGCCAAGACGATGGCGGACCTCGCCCACGCGCACGAGGCCCTCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003593 AAA+ ATPase domain (Domain)
 [36-201]  9.69999663390112e-05 SM00382
SM00382   AAA
IPR011990 Tetratricopeptide-like helical (Domain)
 [367-503]  5.29999999999999e-10 G3DSA:1.25.40.10 [624-819]  5.29999999999999e-10 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
SignalP No significant hit
TMHMM No significant hit