close all open/close all

CDS information : Alip_00070


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction10,399 / 9,167 / - [in whole cluster]
10,399 / 9,167 / - [in contig]
Locationcomplement(9167..10399) [in whole cluster]
complement(9167..10399) [in contig]
TypeCDS
Length1,233 bp (410 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)LipGtf
Gene
Gene (GenBank)lipGtf
EC number
Keyword
  • D-digitoxose
Note
Note (GenBank)
  • putative glycosyltransferase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Family/Domain
FD
IPR006326

close this sectionSequence

selected fasta
>glycosyltransferase [LipGtf]
MTEPHPPRHYLFFAAPAHGHVRPTLPVAAELVRRGHRVSYATTAPFAAEVGATGAETVLY
RPALPDFAGAAPGDSPDWLPLALTAAIAESSALLPAIVDRFGDARPDVVAYDTTMNPAGR
LLTRLWQLPALEFSPVFLPQRTSNPGFSLAAMLRGSPQDGAAERPAVRRFREDLTALLAA
HGAADVSPLDFVTGFQGPRMAFFPRDFQPGGESFDERHVFVGPCLDPSPPSAAWQPPSDG
RPVVLVSLGTSYGNRPEFFRMCVKAFADSPWHAVLTVGRAGVDPAELGPLPAHVEVHRWL
PHLAVLPHARVFVCQAGMGSVMEALSCGTPLVLAAQAREQQMVARRAVALGLGTEVPGGT
DLTAEALLDAVGSVADGREVHASVAGLRERIREAGGTTRAADVLERLGAG
selected fasta
>glycosyltransferase [LipGtf]
GTGACCGAACCGCACCCCCCGCGCCACTATCTCTTCTTCGCCGCTCCCGCCCACGGGCAT
GTGCGGCCCACGCTGCCCGTCGCAGCCGAGCTGGTGCGTCGCGGCCACCGGGTCTCGTAC
GCCACGACCGCGCCGTTCGCCGCCGAGGTCGGCGCGACGGGTGCCGAGACCGTGCTGTAC
CGCCCGGCCCTGCCCGACTTCGCCGGGGCCGCGCCCGGCGACTCCCCCGACTGGCTCCCG
CTCGCGCTGACGGCGGCGATCGCCGAGTCCTCGGCGCTGCTGCCGGCGATCGTGGACCGC
TTCGGCGACGCACGGCCGGACGTGGTGGCGTACGACACGACCATGAATCCGGCCGGCCGC
CTGCTGACACGGCTGTGGCAGCTGCCCGCACTGGAGTTCTCCCCGGTCTTCCTGCCCCAG
CGCACCAGCAACCCGGGGTTCTCCCTCGCGGCCATGCTGCGGGGCTCCCCGCAGGACGGT
GCGGCCGAGCGGCCGGCCGTGCGCCGGTTTCGCGAGGACCTGACCGCGCTGCTGGCCGCG
CACGGGGCGGCGGACGTCTCGCCGCTGGACTTCGTAACCGGCTTCCAGGGTCCGCGCATG
GCCTTCTTCCCGCGCGACTTCCAGCCGGGCGGCGAATCCTTCGACGAGCGGCACGTCTTC
GTCGGGCCCTGTCTGGACCCGTCCCCGCCGTCCGCCGCGTGGCAGCCGCCCTCGGACGGC
AGACCCGTCGTGCTGGTCTCGCTCGGCACCTCCTACGGCAACCGCCCGGAGTTCTTCCGC
ATGTGTGTGAAGGCCTTCGCGGACAGCCCCTGGCACGCGGTGCTGACCGTGGGCCGCGCG
GGGGTCGATCCCGCCGAACTCGGGCCGCTGCCCGCCCACGTGGAGGTGCACCGGTGGCTG
CCGCACCTCGCCGTGCTGCCGCATGCGCGAGTGTTCGTCTGCCAGGCCGGCATGGGCAGT
GTGATGGAGGCCCTGTCCTGCGGCACGCCACTGGTCCTGGCGGCGCAGGCCCGGGAGCAG
CAGATGGTGGCGCGCCGGGCGGTCGCGCTGGGCCTGGGCACCGAGGTGCCCGGCGGCACG
GACCTGACGGCCGAGGCACTGCTGGACGCCGTGGGTTCCGTGGCGGACGGCCGGGAGGTG
CACGCGAGCGTGGCCGGTCTGCGCGAGCGCATCCGGGAGGCGGGCGGCACCACGCGTGCC
GCGGACGTCCTGGAACGCCTCGGCGCCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [237-378]  8.00000000000001e-13 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [11-63]  3.8e-06 PF03033
PF03033   Glyco_transf_28
IPR006326 UDP-glycosyltransferase, MGT (Family)
 [13-407]  3.39999999999996e-106 TIGR01426
TIGR01426   MGT
SignalP
 [1-19]  0.427 Signal
Bacteria, Gram-negative   
TMHMM No significant hit