close all open/close all

CDS information : Alip_00080


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction11,284 / 10,415 / - [in whole cluster]
11,284 / 10,415 / - [in contig]
Locationcomplement(10415..11284) [in whole cluster]
complement(10415..11284) [in contig]
TypeCDS
Length870 bp (289 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)LipDig1
Gene
Gene (GenBank)lipDig1
EC number2.7.7.24
Keyword
  • D-digitoxose
Note
Note (GenBank)
  • putative dNDP-glucose synthase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
Q9AGY4
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [LipDig1]
MRGIVLAGGSGTRLRPVTRVASKQLLPVYNKPMIYYPLSVLMHAGIREILIISSPGFLGS
YRDLLGDGRWLGLEISYAEQPSPDGLADALRIGRHFAGDDTIALILGDNIFYSHQLPAML
QGERQRLDGCTLFGYPVADPERYGIAVTDADGTLLSLEEKPEKPRSNLAVTGLYFYDNDA
VDLVRGLTPSARGELEITDLNALYLTAGRARLVNLGRGSAWFDTGTHDSLLDAATFVQLI
EKRQGIRIACIEEVAYRMGFIDADQLFEIGRRTGMSTEYGRYVIDLAGT
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [LipDig1]
ATGCGTGGAATCGTCCTGGCAGGGGGATCCGGCACGCGGCTGAGGCCCGTCACCCGCGTC
GCCTCGAAGCAGCTCCTGCCGGTCTACAACAAGCCGATGATCTACTACCCCCTGTCCGTG
CTGATGCACGCGGGCATCCGGGAGATCCTGATCATCAGCTCGCCGGGGTTCCTCGGCTCC
TACCGCGATCTGCTCGGTGACGGCCGATGGCTGGGCCTGGAGATCTCCTACGCCGAGCAG
CCGAGCCCCGACGGCCTCGCCGACGCCCTGCGCATCGGCCGGCACTTCGCGGGGGACGAC
ACCATCGCCCTCATTCTCGGCGACAACATCTTCTACAGCCACCAGCTGCCCGCCATGCTC
CAGGGCGAGCGGCAACGGCTCGACGGCTGCACCCTGTTCGGCTACCCGGTGGCCGACCCC
GAGCGGTACGGCATCGCCGTCACGGACGCCGACGGAACGCTGCTCTCGCTGGAGGAGAAG
CCGGAGAAGCCCCGGTCGAACCTGGCGGTGACCGGCCTGTACTTCTACGACAACGACGCC
GTGGACCTGGTACGTGGACTGACCCCCTCGGCCCGCGGCGAGCTGGAGATCACCGATCTC
AACGCCCTGTATCTGACGGCCGGCCGGGCCCGCCTGGTCAATCTGGGCCGCGGCAGCGCC
TGGTTCGACACCGGCACGCACGACAGCCTGCTCGACGCGGCGACGTTCGTGCAGCTCATC
GAGAAGCGCCAGGGCATCCGCATCGCCTGCATCGAGGAGGTGGCGTACCGCATGGGCTTC
ATCGACGCCGACCAGCTGTTCGAGATCGGCCGGCGGACCGGCATGAGCACCGAGTACGGC
CGGTACGTGATCGATCTGGCCGGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [3-237]  8.30000000000004e-60 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-287]  1.9e-122 TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit