close all open/close all

CDS information : Alip_00090


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction12,273 / 11,305 / - [in whole cluster]
12,273 / 11,305 / - [in contig]
Locationcomplement(11305..12273) [in whole cluster]
complement(11305..12273) [in contig]
TypeCDS
Length969 bp (322 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)LipDig2
Gene
Gene (GenBank)lipDig2
EC number4.2.1.46
Keyword
  • D-digitoxose
Note
Note (GenBank)
  • putative 4,6-dehydratase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
Q54116
PmId
[7883182] Cloning of the genes encoding thymidine diphosphoglucose 4,6-dehydratase and thymidine diphospho-4-keto-6-deoxyglucose 3,5-epimerase from the erythromycin-producing Saccharopolyspora erythraea. (Gene. , 1995)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [LipDig2]
MRALVTGAAGFIGSAFVRSSLTQPGSAFPEMEITAFDALTYAGNTENLSSVADDPRFTFV
RGDIADGKLLAEVLPGHDIVLNFAAETHVDRSIEGPSVFVRTNVLGTHTLLEAARRAGVE
RFVQISTDEVYGSIDTGSWTEESALCPNSPYAAAKAGADHLALAYARTYGMHVCITRCSN
NYGPHQFPEKVIPRFVTLLMEGHRVPLYGDGGNVRDWLHVDDHCAGIRLVLEKGKPGEVY
HIGGGTELTNAELARLLLEEFGHGADRVERVPDRLGHDRRYSLDDSKLRALGYRPGVPFA
EGLRATVAWYRENTSWWKPLLP
selected fasta
>putative dTDP-glucose 4,6-dehydratase [LipDig2]
ATGCGCGCCCTAGTGACCGGAGCGGCCGGTTTCATCGGCTCGGCTTTCGTCCGGAGCTCC
CTCACGCAACCCGGGTCCGCTTTCCCGGAGATGGAGATAACGGCCTTCGACGCGCTGACG
TACGCCGGGAACACGGAGAATCTCAGCTCGGTCGCGGACGATCCGCGTTTCACGTTCGTC
CGGGGCGACATCGCCGACGGGAAACTGCTCGCCGAGGTGCTGCCGGGCCACGACATCGTG
CTCAATTTCGCGGCGGAGACCCATGTGGACCGCTCCATCGAGGGCCCGTCGGTGTTCGTG
CGAACGAACGTCCTGGGGACTCACACGCTCCTCGAAGCCGCACGTCGGGCGGGGGTTGAG
CGGTTCGTGCAGATCTCCACGGACGAGGTGTACGGGTCGATCGACACCGGATCCTGGACC
GAGGAGTCCGCGCTCTGCCCGAACTCGCCGTACGCCGCGGCCAAGGCCGGCGCCGACCAT
CTGGCGCTGGCCTACGCCCGGACGTACGGAATGCACGTCTGTATCACCCGGTGTTCCAAC
AACTACGGCCCCCATCAATTCCCGGAGAAAGTCATCCCACGCTTTGTGACCCTGCTCATG
GAAGGGCACAGAGTGCCGCTGTACGGCGACGGCGGAAATGTCCGCGACTGGCTGCACGTG
GACGACCACTGCGCCGGTATTCGCTTGGTCCTGGAAAAGGGGAAACCGGGCGAGGTGTAT
CACATCGGCGGCGGCACAGAACTCACCAATGCGGAGCTGGCGCGGCTGCTGCTGGAGGAA
TTCGGCCACGGTGCCGACAGGGTCGAGCGGGTCCCCGACCGGCTGGGCCACGACCGGCGC
TACTCACTCGACGACTCGAAACTCCGCGCTCTGGGGTACCGGCCCGGCGTCCCGTTCGCC
GAGGGCCTGCGGGCGACCGTCGCCTGGTACCGGGAGAACACCTCCTGGTGGAAGCCACTG
CTGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-243]  2.70000000000002e-67 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [3-320]  7.79999999999999e-128 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-190]  5.30000000000001e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [138-166]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-27]  0.865 Signal
Bacteria, Gram-positive   
 [1-22]  0.974 Signal
Eukaryota   
 [1-22]  0.926 Signal
Bacteria, Gram-negative   
TMHMM No significant hit