close all open/close all

CDS information : Alip_00100


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction12,641 / 13,666 / + [in whole cluster]
12,641 / 13,666 / + [in contig]
Location12641..13666 [in whole cluster]
12641..13666 [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative methyltransferase
Product (GenBank)LipMt
Gene
Gene (GenBank)lipMt
EC number2.1.1.-
Keyword
  • glutamic acid
Note
Note (GenBank)
  • putative N-methyltransferase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
ACC
Q7X2G8
NITE
Gilvo_00100
PmId
[22800463] Roles of the Synergistic Reductive O-Methyltransferase GilM and of O-Methyltransferase GilMT in the Gilvocarcin Biosynthetic Pathway. (J Am Chem Soc. , 2012)

close this sectionSequence

selected fasta
>putative methyltransferase [LipMt]
MEVSLMGLAGMGWIAKSLTAAAELGLADHLDGTPMTAEELAKQTGTHPETLEALLRILSA
LGVFRRDDAGVYRNSALSDQLRDDHPQSMRHYVMLSGGLYADTFTAVTHTLRTGESAFRH
LHGTRIYEYLEQRPAEADLYDKAMADLARPVAAALAGTYDFGAVRSVLDVGGNSGELLKG
LLTAHPHLTGTCLDRPDVCARATAELAASDREDLKDRLVYRPGDFLQEVPAGSDLYTVKN
VLHNWNHEHSVVILGRIREAMERTDADRSAGRRARLLVIEPLIETDLDWMRVLFQMVVCE
DGTRGRTDEVQRAQIAEAGLEVLDTLRLSTGHTAHICAAAH
selected fasta
>putative methyltransferase [LipMt]
GTGGAAGTCAGCCTCATGGGCCTGGCGGGAATGGGCTGGATCGCGAAGTCGCTGACCGCC
GCCGCGGAACTCGGCCTCGCCGACCACCTCGACGGCACGCCGATGACCGCGGAGGAACTC
GCCAAGCAGACCGGGACCCATCCCGAGACGCTCGAGGCGCTGCTGCGGATCCTGTCCGCG
CTCGGCGTCTTCCGCCGCGACGACGCCGGCGTGTACCGCAACTCCGCGCTGTCCGACCAG
CTCCGCGACGACCACCCGCAGTCGATGCGGCACTACGTGATGCTCTCCGGCGGCCTGTAC
GCCGACACCTTCACCGCCGTCACCCACACCCTGCGCACCGGCGAGTCCGCCTTCCGCCAC
CTGCACGGCACCCGCATCTACGAGTACCTCGAGCAGCGGCCCGCCGAGGCGGACCTGTAC
GACAAGGCCATGGCCGACCTGGCCCGGCCCGTCGCCGCGGCCCTCGCCGGGACCTACGAC
TTCGGCGCCGTCCGCAGTGTGCTCGACGTCGGCGGCAACAGCGGAGAGCTGCTCAAGGGG
CTGCTCACCGCCCACCCGCACCTGACCGGTACGTGCCTGGACCGGCCGGACGTCTGTGCC
CGCGCCACCGCTGAACTGGCCGCCTCCGACCGCGAGGACCTCAAGGACCGGCTCGTCTAC
CGGCCGGGTGACTTCCTTCAGGAGGTGCCCGCCGGCTCCGACCTGTACACCGTCAAGAAC
GTGCTGCACAACTGGAACCACGAGCACAGCGTCGTGATCCTCGGCCGCATCCGGGAGGCC
ATGGAGCGCACCGACGCCGACCGGTCCGCCGGCCGGCGGGCCCGGCTGCTGGTCATCGAG
CCACTGATCGAGACCGACCTCGACTGGATGCGCGTGCTGTTCCAGATGGTCGTCTGCGAG
GACGGCACCCGAGGCCGCACCGATGAGGTCCAGCGGGCCCAGATCGCCGAGGCCGGCCTC
GAGGTGCTCGACACGCTCCGCCTCTCCACAGGTCACACCGCCCACATCTGCGCCGCCGCT
CACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [70-293]  2.59999999999998e-44 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [7-79]  6.3e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR012967 Plant methyltransferase dimerisation (Domain)
 [17-61]  8.40000000000001e-05 PF08100
PF08100   Dimerisation
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-329]  4.19999771339581e-11 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-21]  0.784 Signal
Eukaryota   
 [1-20]  0.5 Signal
Bacteria, Gram-negative   
TMHMM No significant hit