close all open/close all

CDS information : Alip_00110


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction13,678 / 14,511 / + [in whole cluster]
13,678 / 14,511 / + [in contig]
Location13678..14511 [in whole cluster]
13678..14511 [in contig]
TypeCDS
Length834 bp (277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)LipX2
Gene
Gene (GenBank)lipX2
EC number
Keyword
  • tetramic acid moiety
Note
Note (GenBank)
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
[25621700] Discovery of a new family of Dieckmann cyclases essential to tetramic acid and pyridone-based natural products biosynthesis. (Org Lett. , 2015)
Related Reference
ACC
F1DI35
PmId
[25621700] Discovery of a new family of Dieckmann cyclases essential to tetramic acid and pyridone-based natural products biosynthesis. (Org Lett. , 2015)

close this sectionSequence

selected fasta
>putative cyclase [LipX2]
MTVQQPLATTAPPTWKVLNEGGSAEPVVLAVDFAVSGRPESTFSDLGRLLARGVPLWETR
QPEPEQARTFGGEDFASYWVRGVRDTGRPVRAVLGYCVGGLYAARVAQLLAAEQDEAPAV
VLFDPEPPHRAGMVADFRAAVARLSSVLSPEESALAGQAADEAAQQSAGIAALGAALTEV
FTGIAGAAFDRAGLPAGLADELSGAYAAFVAYIAAAAAFDPAVSWAGATALTTPAADPHA
RYARRLIPVDAAHDDILRSPLTADVLTGLLTRSRPQG
selected fasta
>putative cyclase [LipX2]
GTGACCGTGCAGCAGCCCCTGGCGACCACCGCACCGCCCACCTGGAAGGTCCTCAACGAG
GGCGGCAGCGCCGAACCCGTCGTGCTGGCCGTCGACTTCGCCGTCTCCGGGCGCCCCGAA
TCGACGTTCAGCGACCTCGGCCGCCTCCTCGCCCGGGGCGTCCCGCTGTGGGAGACCCGG
CAGCCGGAACCGGAGCAGGCCCGCACCTTCGGCGGCGAGGACTTCGCGTCGTACTGGGTG
CGGGGCGTGCGCGACACCGGCCGCCCCGTGCGCGCCGTGCTCGGCTACTGCGTCGGCGGC
CTGTACGCGGCCCGCGTCGCGCAGCTCCTCGCGGCGGAGCAGGACGAGGCACCGGCCGTT
GTCCTGTTCGACCCCGAGCCGCCCCACCGCGCCGGCATGGTCGCGGACTTCCGGGCCGCC
GTGGCACGGTTGTCCTCCGTGCTCAGCCCGGAGGAGTCCGCGCTGGCCGGGCAGGCCGCC
GACGAGGCGGCCCAGCAGAGCGCCGGCATCGCCGCGCTCGGCGCCGCGCTCACCGAGGTC
TTCACCGGCATCGCCGGCGCCGCCTTCGACCGGGCCGGGCTGCCCGCCGGGCTCGCCGAC
GAACTCAGCGGCGCCTATGCGGCGTTCGTCGCCTACATCGCGGCAGCCGCCGCGTTCGAC
CCGGCCGTGTCGTGGGCCGGCGCCACCGCGCTGACCACTCCCGCGGCCGACCCGCACGCC
CGGTACGCCAGGCGTCTCATCCCCGTCGACGCGGCCCACGACGACATCCTGCGCAGCCCC
CTCACCGCGGACGTCCTCACCGGCCTGCTCACCCGGTCCCGTCCGCAGGGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-30]  0.083 Signal
Eukaryota   
TMHMM No significant hit