close all open/close all

CDS information : Alip_00120


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction14,608 / 16,851 / + [in whole cluster]
14,608 / 16,851 / + [in contig]
Location14608..16851 [in whole cluster]
14608..16851 [in contig]
TypeCDS
Length2,244 bp (747 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)LipNrps
Gene
Gene (GenBank)lipNrps
EC number
Keyword
  • glutamic acid
Note
Note (GenBank)
  • putative non-ribosomal peptide synthetase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)

close this sectionPKS/NRPS Module

8
C36..313
A507..595
PCP673..741

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [LipNrps]
MQSAEKAKPADGAAAALLATLTHKRRLDAATPKESALWLLDRLLPEAGVNNVPLAVRVDG
RLDAAALQAAVDGLVRRHEVLRTVYLDRQAGLVREVLGEDTPGPRVEVHDTVAGVPEKAL
REFAATPIRCDGRLMLRAAVFRGPDADTLAVVVHHLVFDAASVPVLIAELAAAYDARATG
RDLPDELRTPVAALRDPAPREESLAYWRTALDGFDPAGLDLDCARPAPARATLVGDTVLH
VLDDETRDLVRGLQRTQRAPEAVILFTAFCLLLAAHGAGPDLVVGSPVNIRPPEAPSAIG
YHVNTLPLRLTVDPGRGFRDLVKEARTAFFGALAHSDTPVDAIAHETAREPVSWRDTLFQ
HMFNYVPVESAGALTLGGAPARALHVETGFSKFDLELFVQSGADHIGLRILYCSEVLDRA
DAQALAHRYAALLHTVAADPDRPVGELDVWSAEDRALPGPGTARSVPDTEVEADGDLDAF
RTSPDGSVLGLADAAAHCAAAGGYPYVVHPLDARHIAVVGRAGNRLPAGVRGEVCLVRPD
RATHVATGWTGSLGRDGALELYGRAERVALLHGRAVHPERVEAALLAHPEVTRAALVVTD
GTALAFVTADERPGLADDVAGHAARLLPRAAQPARVIRTDTLPLRPDHGWDTAALMALAA
AEPESGQDDADGLVAELRGLWRDLLGLAEPVGADADFFSLGGHSLLGAQLVQRVDDVTGR
RIKLADLFDNPTPRSLARHLRAPRAGS
selected fasta
>non-ribosomal peptide synthetase [LipNrps]
GTGCAGTCAGCCGAGAAGGCGAAGCCGGCCGACGGCGCCGCAGCGGCCCTGCTTGCCACA
CTGACCCACAAGCGGCGGCTGGACGCGGCAACGCCCAAGGAGAGTGCCCTGTGGTTGCTG
GACCGGCTGCTGCCCGAGGCCGGCGTCAACAACGTCCCCCTCGCCGTCCGCGTCGACGGA
CGGCTCGACGCCGCCGCGCTCCAGGCCGCCGTCGACGGCCTGGTACGCCGCCACGAGGTG
CTGCGCACGGTCTACCTCGACCGGCAGGCGGGCCTCGTCCGCGAGGTGCTCGGCGAGGAC
ACCCCGGGCCCGCGCGTCGAGGTCCACGACACTGTCGCCGGCGTACCGGAGAAGGCGCTG
CGGGAGTTCGCCGCGACCCCCATCCGGTGTGACGGCCGGCTGATGCTGCGCGCGGCCGTC
TTTCGGGGCCCTGACGCCGACACCCTCGCCGTGGTGGTCCACCACCTCGTCTTCGACGCC
GCCTCCGTGCCGGTCCTGATCGCCGAACTCGCCGCCGCCTACGACGCCCGCGCCACGGGC
CGCGACCTGCCCGACGAGCTGCGCACCCCCGTCGCGGCACTGCGGGACCCCGCGCCCCGC
GAGGAGAGCCTCGCCTACTGGCGCACCGCGCTCGACGGCTTCGACCCGGCCGGTCTCGAC
CTGGACTGCGCGCGTCCCGCACCGGCCCGGGCCACCCTGGTGGGCGACACCGTCCTGCAC
GTCCTGGACGACGAGACCCGGGACCTGGTGCGCGGACTTCAGCGCACCCAGCGGGCACCT
GAGGCCGTCATCCTCTTCACCGCCTTCTGCCTGCTGCTCGCGGCGCACGGGGCCGGCCCC
GACCTCGTCGTCGGATCCCCCGTCAACATCCGGCCCCCCGAGGCCCCGTCCGCGATCGGC
TACCACGTCAACACCCTGCCGCTACGCCTGACCGTCGACCCCGGCCGCGGGTTCCGCGAC
CTGGTGAAGGAGGCGCGCACCGCCTTCTTCGGCGCGCTCGCCCACAGCGACACACCTGTG
GACGCCATCGCCCACGAGACCGCGCGCGAACCGGTGTCCTGGCGCGACACCCTCTTCCAG
CACATGTTCAACTACGTGCCCGTGGAGTCCGCCGGGGCCCTCACCCTGGGCGGGGCCCCG
GCCCGGGCGCTGCACGTCGAGACCGGATTCAGCAAGTTCGACCTGGAGCTGTTCGTCCAG
TCCGGCGCCGACCACATCGGCCTGCGCATCCTGTACTGCTCCGAGGTGCTCGACCGGGCC
GACGCCCAGGCCCTGGCCCACCGCTACGCGGCCCTCCTGCACACCGTCGCCGCCGATCCC
GACCGGCCCGTCGGTGAGCTGGACGTGTGGAGCGCCGAGGACCGCGCGCTGCCCGGTCCG
GGCACGGCACGGTCGGTGCCGGACACCGAGGTCGAGGCCGACGGCGACCTCGACGCGTTC
CGCACCTCCCCCGACGGTTCGGTGCTCGGTCTCGCGGACGCGGCGGCCCACTGCGCGGCC
GCCGGCGGCTACCCCTACGTCGTTCACCCGCTCGACGCCCGGCACATCGCCGTCGTCGGG
CGGGCCGGCAACCGGCTCCCGGCCGGGGTTCGCGGCGAGGTGTGCCTCGTACGACCCGAC
AGGGCCACCCACGTGGCCACCGGCTGGACCGGCAGCCTGGGCCGCGACGGCGCGCTGGAG
CTGTACGGCCGGGCCGAGCGCGTCGCGCTGCTGCACGGCCGGGCGGTGCATCCCGAACGG
GTGGAGGCCGCGCTGCTGGCGCATCCCGAGGTCACCCGGGCGGCGTTGGTCGTCACGGAC
GGGACGGCACTCGCGTTCGTCACCGCGGACGAGCGGCCCGGGCTCGCGGACGACGTCGCC
GGACACGCCGCCCGGCTGTTGCCGCGCGCGGCGCAGCCGGCCCGGGTGATCCGCACCGAC
ACGCTGCCACTGCGCCCCGACCACGGCTGGGACACGGCGGCGCTGATGGCGCTCGCCGCG
GCCGAGCCGGAGAGCGGGCAGGACGACGCCGACGGGCTGGTGGCCGAGCTGCGCGGGCTG
TGGCGCGACCTCCTCGGCCTCGCGGAACCCGTCGGCGCCGACGCCGACTTCTTCTCACTC
GGTGGGCATTCGCTGCTCGGCGCCCAACTGGTGCAGCGCGTCGACGACGTGACGGGGAGG
CGGATCAAGCTGGCCGACCTGTTCGACAATCCGACGCCGCGCAGCCTCGCGCGGCATCTG
CGGGCCCCGCGTGCCGGCAGCTGA
[8] C36..313
[8] A507..595
[8] PCP673..741
[8] C106..939
[8] A1519..1785
[8] PCP2017..2223

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [507-595]  1.9e-06 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [36-313]  7.00000000000005e-39 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [699-714]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [673-741]  PS50075
PS50075   ACP_DOMAIN
 [664-742]  7e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [666-742]  9.80000272130218e-17 SSF47336
SSF47336   ACP_like
 [676-740]  1.7e-14 PF00550
PF00550   PP-binding
SignalP
 [1-29]  0.162 Signal
Eukaryota   
TMHMM No significant hit