close all open/close all

CDS information : Alip_00160


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction45,491 / 55,324 / + [in whole cluster]
45,491 / 55,324 / + [in contig]
Location45491..55324 [in whole cluster]
45491..55324 [in contig]
TypeCDS
Length9,834 bp (3,277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)LipPks4
Gene
Gene (GenBank)lipPks4
EC number
Keyword
Note
Note (GenBank)
  • putative type I polyketide synthase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)

close this sectionPKS/NRPS Module

6 malonyl-CoA
7 malonyl-CoA
KS35..410
AT560..865
DH917..1084
KR1388..1564
ACP1676..1746
KS1768..2143
AT2293..2606
kr2938..3038
ACP3197..3267

close this sectionSequence

selected fasta
>polyketide synthase [LipPks4]
MATPNEKVVEALRASLKETELLRQQNNALRAASSEPVAIVGMGCRFPGGVVSPEGLWEVV
LSGADVISEFPTDRGWDVEGLYDPDPDRPGKTYGRRGGFVDAVADFDAGFFGISPREALA
MDPQQRLLLETSWEAFERAGIDPATLRGSRTGVFAGVMYHDYASRLREVPGHLEGLMGTG
NATSVIAGRLSYTFGLEGPSVSVDTACSSSLVALHLAVQALRAGECEMALAGGVTVMATP
EAFINFSRQRGLAADGRCKAFGAGADGTGWAEGAGMLLVERLSDAQRLGHPILAVVRGSA
VNQDGASNGLTAPNGPAQQRVIRQALATARLEAGQVDVVEAHGTGTSLGDPIEAQALMET
YGQERPAERPLWLGSLKSNIGHAQAAAGVGGVIKMVMALREGVLPRTLHADEPSPHIDWT
AGAVRLLTEQSAWPDTQRPRRAAVSSFGFSGTNAHVIIEQAPDPAHPADTADTNPGDGSV
VPWVISGASPQALRAQAEQLRSYIAERPGLRPADVAFSLATTRSVLEHRAVVVGADHDDL
LDGLGELSLTGPVVEGMSAFLFTGQGAQRVGMGRELYDTFPAFRNALDKVCAVLDPLLPR
PSREVMWDEDPEALSRTEFTQPTLFAIEVALFRLLESWGIHPDAVAGHSIGEIAAAHVTG
VLSLTDACVLVAARGRLMQALPHDGVMIAIQATEDEVLPLLEKVTGQADIAAVNAPEAVV
ISGAETEVEHVAGILTAQGRRVKRLTVSHAFHSPLMDPILKDFQTVVEGLSFHQPSLPFV
STVTGTVAGAEITEPAYWVRHVRQTVRFADGLRTLHELGVRKFIEIGPDAILTGLVEQTL
DTQAVPVLRRDRDEVRAAVEAAGGFFTRGGSVDWPALLAGGRRVDLPTYAFQHERYWLEA
PVSVGDVAAVGLSAARHPLLGGAITLADRSGVLLTGRLSLATHAWLADHAVHSTVLIPGT
ALVELALRAGEEVGCDTVEELTLQAPLVLPATGARAVQVQIVVGEPDARNLRPVDVYARV
EDDTGEAPWTCQATGLLAPGTGAPEEATDFAVWPPRDAEPVDIGGFYDAMADRGYDYGPV
FRGLRSAWRRGDEVFAEIALPEEAAGAAREFGVHPALLDSALHAATAATDEHGDVTRVPF
SWRRVALYAAGATALRVHLTSAGETLTLRAADTEGQLVASVESLALREVSPEQLAVADDP
DSLFEVEWVSAADGGSTEAGTASWAVLGDSPLAEGGPVFADVEALVASSQDLPGTVVLEC
PAVEGAPVPDAVRDRLTGVLSVLQQWVADERLASSRLVVVTRGAVAASANEPADVRVAPV
WGLVCAAQAEHPGRFVLADLPVGAGARELSAGLACDEPQWAIRDGAVRVPRLVRAQPAVS
GVPAFGNGPVLVTGATGALGKLVARHLVSVHGVRELVLLSRRGLAADGMDTLRDELTHQG
ASVEVLACDAADRDALAQVLDGRELTAVIHAAGVLDDGVLEALDASRLDTVLRPKMDAAW
NLHELTRHLDLTAFVLFSSAAGVLGNAGQANYAAANVFLDALAQTRRTESLPGLSLAWGL
WADDSAMTAGLTEADVRRLSRSGAGALSADEGLALLDTAAMAVHHGLLIPVRLDLAALRT
ANAAPERVPQILRGLLPTPARSRRRAAGAATGTAADGGELASTLAPLDAPARAAHVLDLI
RSAVASVLGHASPDAVEPEKSFRDLGFDSLTAVDLRNRLTATTGLRLPATLVFDYPTSAA
LAEHVMTQVVGEADRVTTLVPAEAGADDPIVIVGMSCRYPGDVMTPEDLWDLVLSGGDAV
SEFPSDRGWDLENVYHPDPDHPGTTYSREGGFLHRAAEFDAEFFGISPREALAMDPQQRL
LLETSWEAFERAGIDPATLRGSRTGVFAGVMYHDYASRLREVPGHMEGLLGTGTAASVVS
GRLSYTFGLEGPAVTVDTACSSSLVALHLAVQALRAGECEMALAGGVTVMATPGAFINFS
RHRGLSPDGRCKAFAAGADGTGWAEGAGMLLVERLSDAERLGHRVLAVVRGSAVNQDGAS
NGLTAPNGPSQQRVIRQALATAGLTPTDIDAVEGHGTGTSLGDPIEVQALQATYGQERPA
EHPLWLGSLKSNIGHAQAAAGVGGVIKMVMALREGVLPRTLHADEPSPHIDWTAGNVRLL
TEQSTWPDTQRPRRAAVSSFGFSGTNAHVIIEQAPDPAHPADTADTNPGDESVVPWVISG
ASPQALRAQAEQLRSYIAERPGLRPADVAFSLATTRGALEHRAVVVGTDLSELAEGLGAL
TQTATAVPGRTAFLFTGQGAQRVGMGRELYDTFPAFRKALDEVCAVLDPLLPRPSREVMW
DEDPEALSRTEFTQPTLFAIEVALFRLLESWGIHPDAVAGHSIGEIAAAHVTGVLSLTDA
CVLVAARGRLMQALPHDGVMIAVQATEDEVLPLLEKVTGQADIAAVNAPEAVVVSGAETE
VEHVAGILTAQGRRVKRLTVSHAFHSPLMDPILKDFQTVVEGLSFRQPSLPFVSTVTGTV
AGAEITEPAYWVRHVRQTVRFADGLRTLHGLGVRKFIEIGPDAILTGLVEQNQTLDTQAV
PVLRRDRDEVRAAVEAVGRLHLAGIPVDWPAVLPGARRVELPTYAFQHERYWLDPEELAA
AAEDTVAPSGTEVPDPDTRFWGAVADEDLGSLAALLGIDGEKGGAQDRAAVEAALPVLAS
WLGRRQAAARVSHYRVGWTPVARRPDGTTARLRGIWLLTIPARIGADDALVTRLASALGG
AGADVRVVTVGDPGADSYDDLAAEVSSLTADGGELAGVLSLLGLASADGPGDAREAAVGT
LALLRALSGSVASVPVWSLTSGAVSTGGSERVSAPAQAVLWGLGRLLAEDSDVRWAGVVD
VPAPCGDRVLRRLAEVLANPAEETEVAVRDAGVFARRLLRATGAADGPARPTALAPRGTL
LVSGGSDTWRDRVARRLLASGAAHVLVATAPDEPEPASTPGSAVTGVSRVVCDVSDGPAL
AHLAASLPAGPDGRPLTGVVHAPPATASDGPLDKALDEVLGAGLPALAGVSSTAGPIALF
LAVDVDDLVGAPGAGAVAALAGWWEAAARVRTADRAPVRLIAADPDALDLAVLDRAMERA
DGLLVVTGRDWAQYAGTHADTRGRRLLEGVPEARAVLAAAAPAGDAGKSGLLAGVDGPES
LRRVLAAREADHKLATLVELVRGQVAVVLGHASADAVSADGDFMDLGFASLTAVEFGHRL
SAITGLKLPTTLVYDHLNPVELAEHLADELARELTAA
selected fasta
>polyketide synthase [LipPks4]
ATGGCAACGCCCAATGAAAAGGTCGTCGAAGCACTTCGTGCCTCGCTCAAGGAGACGGAG
CTGCTGCGCCAGCAGAACAACGCCCTGCGCGCCGCCTCCAGCGAGCCGGTGGCGATTGTG
GGGATGGGGTGTCGTTTTCCGGGGGGTGTGGTTTCTCCGGAGGGGTTGTGGGAGGTGGTG
TTGTCGGGGGCGGATGTGATTTCCGAGTTCCCGACGGACCGTGGCTGGGACGTGGAGGGC
TTGTACGACCCTGATCCGGACCGTCCTGGAAAGACGTACGGGCGTCGGGGTGGTTTCGTG
GACGCGGTGGCGGACTTCGATGCGGGGTTCTTCGGGATCTCGCCGCGCGAGGCGTTGGCG
ATGGACCCGCAGCAGCGACTGCTGCTGGAGACCTCGTGGGAGGCGTTCGAGCGCGCGGGC
ATCGACCCGGCCACCCTGCGCGGCAGCCGGACGGGCGTCTTCGCAGGCGTCATGTACCAC
GACTACGCGTCGCGTCTGCGGGAGGTACCGGGGCATCTCGAGGGACTGATGGGGACGGGC
AATGCGACGAGTGTGATCGCCGGCCGTCTCTCATACACGTTCGGGCTCGAGGGCCCTTCG
GTGAGTGTGGACACGGCATGCTCGTCGTCGCTGGTGGCACTGCACCTTGCGGTGCAGGCA
CTGCGCGCCGGTGAGTGCGAGATGGCACTCGCGGGTGGTGTCACGGTGATGGCGACGCCG
GAGGCGTTCATCAACTTCAGCCGGCAGCGGGGGCTGGCGGCGGATGGTCGTTGCAAGGCC
TTCGGCGCGGGTGCGGACGGCACCGGGTGGGCCGAGGGCGCGGGCATGCTGCTGGTAGAG
CGCCTGTCCGACGCCCAGCGCCTGGGACACCCGATCCTGGCGGTCGTCCGGGGCAGCGCG
GTCAACCAGGACGGCGCGTCCAACGGCCTCACGGCGCCCAACGGCCCCGCTCAGCAGCGG
GTGATCCGGCAGGCGCTCGCCACCGCGAGACTGGAGGCCGGGCAGGTCGATGTGGTGGAG
GCCCATGGCACGGGCACGTCGCTGGGCGACCCCATCGAGGCGCAGGCCCTGATGGAGACC
TACGGGCAGGAGCGTCCTGCCGAACGGCCGTTGTGGCTGGGGTCGTTGAAGTCCAACATC
GGGCACGCCCAGGCGGCAGCCGGTGTCGGCGGTGTGATCAAAATGGTGATGGCGCTGCGC
GAAGGCGTCCTGCCACGCACCCTCCACGCGGACGAACCGTCCCCGCACATCGACTGGACA
GCGGGTGCGGTACGACTGCTCACCGAACAGTCCGCCTGGCCGGACACGCAACGGCCGCGG
CGGGCAGCGGTGTCATCGTTCGGGTTCAGCGGCACCAACGCCCACGTGATCATCGAGCAG
GCCCCCGATCCGGCCCATCCGGCCGACACCGCCGACACCAATCCCGGAGACGGGAGTGTC
GTGCCATGGGTGATCTCGGGCGCATCCCCGCAAGCCCTGCGAGCGCAGGCGGAGCAACTG
CGGTCGTACATCGCCGAACGCCCCGGACTACGCCCGGCAGATGTGGCGTTCTCCCTCGCC
ACCACTCGGAGCGTTCTGGAACACCGCGCCGTCGTCGTCGGCGCCGACCACGACGACCTC
CTGGACGGCTTGGGTGAGTTGTCCCTCACGGGGCCCGTGGTAGAGGGCATGTCCGCCTTC
CTGTTCACGGGGCAGGGGGCTCAGCGGGTCGGGATGGGCCGGGAGCTGTATGACACCTTC
CCCGCATTCCGGAACGCACTGGACAAGGTGTGCGCGGTACTGGATCCATTGCTGCCACGC
CCCTCACGTGAAGTGATGTGGGACGAAGACCCAGAAGCCCTGTCCCGGACCGAGTTCACC
CAGCCCACACTGTTCGCCATCGAGGTCGCACTGTTCCGCCTGCTGGAGTCATGGGGAATC
CACCCCGACGCAGTGGCCGGACACTCCATCGGAGAAATCGCCGCCGCACACGTGACCGGA
GTACTGTCCCTGACCGACGCATGCGTGCTGGTCGCCGCCCGCGGCCGGCTGATGCAAGCA
CTCCCCCACGACGGCGTAATGATCGCCATCCAGGCAACCGAGGACGAAGTCCTGCCCCTG
CTGGAGAAGGTCACCGGCCAGGCAGACATCGCCGCAGTCAACGCACCCGAAGCCGTCGTC
ATTTCCGGCGCCGAAACCGAAGTCGAACACGTCGCCGGGATTCTCACGGCCCAGGGCAGG
CGAGTGAAGCGACTCACGGTCAGCCACGCCTTCCACTCCCCCCTGATGGACCCGATACTC
AAAGACTTCCAGACCGTCGTCGAAGGACTCTCCTTCCACCAGCCGTCCCTGCCCTTCGTG
TCCACCGTCACCGGAACCGTGGCAGGAGCGGAAATCACCGAACCTGCGTACTGGGTGCGG
CACGTGCGCCAGACCGTCCGCTTCGCCGACGGACTACGAACCCTCCACGAGCTCGGCGTA
CGGAAGTTCATCGAGATAGGCCCCGACGCGATACTGACCGGGCTGGTCGAACAGACCCTC
GACACGCAGGCCGTGCCCGTCCTGCGCCGCGACCGGGACGAAGTACGAGCGGCAGTCGAG
GCGGCCGGCGGCTTCTTCACGCGGGGCGGTTCGGTCGACTGGCCGGCACTGCTGGCCGGT
GGACGGCGAGTCGATCTGCCGACGTACGCCTTCCAACACGAACGGTACTGGCTGGAAGCC
CCCGTCAGCGTCGGTGATGTCGCGGCCGTCGGTCTGAGCGCGGCGCGCCATCCGCTGCTG
GGCGGTGCCATCACGCTTGCCGACCGCTCGGGCGTGCTGCTCACCGGGCGGCTCTCGCTG
GCGACCCACGCTTGGCTGGCGGACCACGCGGTCCACAGCACCGTCCTCATCCCCGGCACC
GCACTGGTCGAGTTGGCGCTGAGGGCTGGTGAGGAGGTCGGCTGCGACACCGTCGAGGAG
CTGACGCTCCAGGCGCCGCTGGTGCTCCCGGCGACCGGCGCCCGCGCCGTCCAGGTGCAG
ATCGTCGTCGGTGAACCGGACGCCCGGAACCTGCGCCCGGTCGACGTGTACGCCCGCGTC
GAGGACGACACGGGCGAGGCCCCGTGGACCTGTCAGGCCACCGGCCTCCTCGCCCCCGGC
ACCGGGGCGCCGGAGGAGGCCACCGACTTCGCCGTCTGGCCGCCGCGCGACGCGGAACCG
GTCGACATCGGTGGCTTCTACGACGCTATGGCCGACCGCGGCTACGACTACGGGCCTGTC
TTCCGGGGCCTGCGCAGCGCCTGGCGCCGCGGCGACGAGGTGTTCGCCGAGATCGCGCTG
CCGGAAGAAGCAGCCGGCGCGGCCCGGGAGTTCGGAGTGCACCCGGCTCTGCTGGACTCC
GCCCTGCACGCCGCCACGGCCGCGACAGACGAACACGGAGACGTTACCCGTGTCCCCTTC
TCGTGGCGCCGCGTCGCGCTGTACGCAGCGGGCGCCACGGCCCTTCGGGTCCACCTCACC
TCAGCCGGGGAGACCCTCACCCTCCGAGCGGCGGACACGGAGGGCCAGTTGGTGGCCTCC
GTGGAGTCGCTGGCGCTGCGCGAGGTGAGCCCGGAGCAGTTGGCGGTCGCGGACGATCCC
GACTCGCTGTTCGAGGTCGAGTGGGTTTCCGCCGCCGACGGTGGCTCCACCGAGGCCGGA
ACCGCCTCTTGGGCGGTGCTGGGGGACTCGCCTCTGGCCGAGGGCGGACCGGTGTTCGCG
GACGTGGAGGCGTTGGTCGCGTCGTCGCAGGACCTGCCCGGCACGGTGGTGTTGGAGTGC
CCGGCAGTGGAGGGCGCCCCGGTGCCCGATGCCGTACGGGACCGGCTCACCGGTGTACTG
AGTGTGCTGCAGCAGTGGGTTGCTGACGAGCGACTGGCGTCCTCACGACTGGTCGTGGTG
ACCCGAGGTGCCGTGGCCGCGTCGGCGAATGAGCCGGCGGACGTGCGGGTCGCGCCGGTG
TGGGGTCTGGTGTGCGCGGCACAGGCCGAACACCCCGGGCGGTTCGTGCTGGCGGATCTT
CCCGTGGGTGCCGGTGCGCGGGAGCTGTCCGCCGGACTGGCCTGCGATGAACCACAGTGG
GCCATACGGGACGGTGCCGTACGCGTCCCACGACTGGTGCGGGCACAGCCTGCGGTCTCC
GGTGTCCCGGCGTTCGGGAACGGTCCGGTGCTGGTCACCGGCGCCACCGGCGCTCTCGGC
AAGCTCGTCGCCCGGCACTTGGTGTCGGTGCACGGGGTGCGGGAGCTGGTACTGCTCAGC
CGGCGCGGGCTCGCCGCCGACGGCATGGACACACTCCGCGACGAACTCACCCACCAGGGC
GCGTCCGTAGAGGTGCTGGCATGCGATGCAGCCGACCGCGACGCGCTGGCGCAGGTGCTG
GACGGCCGTGAGCTGACCGCCGTGATCCATGCGGCCGGAGTCCTCGACGACGGCGTGCTG
GAAGCGTTGGACGCCTCCCGCCTCGACACGGTGCTCCGGCCGAAGATGGACGCGGCATGG
AACCTGCACGAACTCACCCGCCACCTGGACCTGACCGCCTTCGTACTGTTCTCATCCGCC
GCCGGCGTCCTCGGCAACGCCGGCCAGGCCAACTACGCAGCCGCCAACGTCTTCCTCGAC
GCCCTCGCCCAGACCCGGCGCACCGAAAGCCTCCCCGGACTCTCCCTGGCCTGGGGCCTA
TGGGCCGACGACAGTGCCATGACCGCCGGACTCACCGAAGCTGACGTGCGACGGCTGTCG
CGTTCGGGGGCCGGTGCGCTGTCGGCAGACGAGGGGCTCGCGCTCCTCGACACCGCCGCC
ATGGCCGTCCACCACGGCCTGCTGATCCCCGTACGCCTCGACCTCGCCGCCCTGCGCACC
GCCAACGCCGCACCCGAGCGGGTGCCGCAGATCCTGCGCGGACTCCTGCCCACCCCGGCC
CGGAGCCGACGCAGGGCCGCAGGCGCGGCGACCGGCACGGCAGCCGACGGTGGTGAACTC
GCCAGCACACTCGCCCCCTTGGACGCCCCGGCGCGCGCGGCACACGTACTGGACCTGATC
CGGTCGGCCGTCGCGTCGGTGCTCGGGCACGCCTCACCGGACGCGGTCGAGCCCGAGAAG
TCGTTCCGTGACCTCGGCTTCGACTCGCTGACCGCGGTGGACCTGCGCAACCGGCTCACC
GCCACCACCGGTCTGCGTCTGCCCGCCACCCTCGTCTTCGACTACCCGACGTCCGCCGCC
CTGGCCGAGCACGTGATGACACAGGTCGTCGGCGAGGCCGACCGCGTCACCACCCTCGTG
CCCGCGGAGGCCGGCGCCGACGACCCCATCGTGATCGTCGGCATGAGCTGCCGCTATCCC
GGTGACGTCATGACGCCCGAGGACCTGTGGGACCTCGTCCTGTCCGGCGGCGACGCAGTG
TCCGAGTTCCCATCCGACCGCGGCTGGGATCTGGAGAACGTCTACCACCCCGACCCGGAC
CACCCCGGCACCACCTACTCACGCGAGGGCGGGTTTCTGCACCGCGCCGCTGAGTTCGAC
GCGGAGTTCTTCGGGATTTCGCCGCGCGAGGCGTTGGCGATGGATCCGCAGCAGCGGCTG
CTGCTGGAGACGTCGTGGGAGGCGTTCGAGCGCGCGGGCATCGACCCGGCCACCCTGCGC
GGCAGCCGGACGGGCGTCTTCGCAGGCGTCATGTACCACGACTACGCGTCGCGTCTGCGG
GAGGTACCCGGCCACATGGAGGGGCTGCTGGGCACCGGCACCGCCGCCAGCGTGGTCTCC
GGCCGACTGTCGTACACCTTCGGACTGGAGGGCCCGGCGGTGACCGTCGACACCGCCTGC
TCGTCGTCGCTGGTGGCTCTGCACCTTGCGGTACAGGCACTGCGCGCCGGTGAGTGCGAG
ATGGCACTCGCGGGTGGTGTGACGGTGATGGCGACGCCCGGCGCGTTCATCAACTTCAGC
CGGCACCGCGGCCTGTCGCCCGACGGTCGGTGCAAGGCATTCGCGGCGGGTGCGGACGGC
ACCGGGTGGGCCGAGGGCGCGGGCATGCTGCTGGTAGAGCGGCTGTCGGATGCGGAGCGG
CTGGGTCACCGGGTGCTTGCGGTGGTGCGGGGCAGCGCGGTCAACCAGGATGGTGCGTCG
AATGGACTGACGGCACCCAACGGCCCCTCTCAGCAGCGCGTGATCCGGCAGGCGCTCGCC
ACCGCAGGTCTTACTCCGACCGACATCGACGCGGTGGAGGGGCACGGCACCGGCACATCA
CTGGGCGACCCCATCGAAGTGCAGGCCCTCCAGGCGACCTACGGACAGGAACGGCCCGCC
GAACACCCTCTGTGGCTGGGCTCGTTGAAGTCCAACATCGGGCACGCCCAGGCGGCAGCC
GGTGTCGGCGGCGTGATCAAAATGGTGATGGCGCTGCGCGAAGGCGTCCTGCCACGCACC
CTCCACGCGGACGAACCCTCCCCGCACATCGACTGGACGGCAGGAAACGTACGACTGCTC
ACCGAACAGTCCACCTGGCCGGACACGCAACGGCCGCGACGGGCAGCGGTGTCGTCATTC
GGGTTCAGCGGCACCAACGCCCACGTGATCATCGAGCAGGCCCCCGATCCGGCCCATCCG
GCCGACACCGCCGACACCAATCCCGGAGACGAGAGTGTCGTGCCATGGGTGATCTCGGGC
GCATCCCCGCAAGCCCTGCGAGCGCAGGCGGAGCAACTGCGGTCGTACATTGCCGAACGC
CCCGGACTACGCCCGGCAGATGTGGCGTTCTCCCTCGCCACCACGCGCGGGGCGCTGGAG
CACCGGGCCGTGGTGGTGGGCACAGACCTGAGCGAACTCGCCGAGGGCCTGGGCGCATTG
ACCCAGACGGCGACCGCCGTCCCGGGCCGTACCGCCTTCCTGTTCACGGGGCAAGGGGCT
CAGCGGGTCGGGATGGGCCGGGAGTTGTATGACACCTTCCCCGCATTCCGGAAGGCACTG
GACGAGGTGTGCGCGGTACTGGACCCGCTCCTGCCACGCCCCTCACGTGAAGTGATGTGG
GACGAAGACCCAGAAGCCCTGTCCCGGACCGAGTTCACCCAGCCCACACTGTTCGCCATC
GAGGTGGCACTGTTCCGCCTGCTGGAGTCATGGGGAATCCACCCCGACGCGGTAGCCGGA
CACTCCATCGGAGAAATCGCCGCCGCACACGTGACCGGAGTACTGTCCCTGACCGACGCA
TGCGTGCTGGTCGCCGCCCGCGGCCGGCTGATGCAAGCACTCCCCCACGACGGCGTAATG
ATCGCCGTGCAGGCAACCGAGGACGAAGTCCTGCCCCTGCTGGAGAAGGTCACCGGCCAG
GCAGACATCGCCGCGGTCAACGCACCCGAAGCCGTCGTCGTCTCCGGCGCCGAAACCGAA
GTCGAACACGTCGCCGGGATTCTCACGGCCCAGGGCAGGCGGGTGAAGCGACTCACGGTC
AGCCACGCCTTCCACTCCCCCCTGATGGACCCGATACTCAAAGACTTCCAGACCGTCGTC
GAAGGACTCTCCTTCCGCCAGCCGTCCCTGCCCTTCGTGTCCACCGTCACCGGAACCGTG
GCAGGAGCGGAGATCACGGAACCTGCGTACTGGGTGCGGCACGTGCGCCAGACCGTCCGC
TTCGCCGACGGACTACGAACCCTCCACGGACTCGGCGTACGGAAGTTCATCGAGATAGGC
CCCGACGCGATACTGACCGGGCTCGTCGAGCAGAACCAGACCCTCGACACGCAAGCCGTG
CCCGTCCTGCGCCGGGACCGGGACGAGGTACGAGCGGCGGTCGAGGCGGTGGGCCGGCTG
CACCTGGCCGGGATTCCCGTCGACTGGCCGGCCGTGCTGCCCGGCGCACGGCGAGTCGAA
CTGCCCACATACGCCTTCCAGCACGAACGGTACTGGCTGGACCCGGAGGAACTGGCGGCG
GCGGCCGAGGACACGGTTGCCCCCTCCGGCACCGAGGTGCCGGACCCCGACACCCGCTTC
TGGGGGGCAGTGGCCGACGAGGACCTGGGCTCGCTGGCGGCTCTGCTGGGGATCGACGGC
GAGAAGGGCGGGGCGCAGGATCGCGCTGCGGTCGAGGCGGCGTTGCCGGTCCTCGCGTCG
TGGCTGGGGCGTCGGCAGGCCGCCGCTCGCGTGTCGCACTACCGTGTCGGCTGGACCCCC
GTGGCCCGGCGTCCGGACGGCACCACGGCGCGGCTGCGGGGCATCTGGCTGCTGACCATA
CCGGCGCGGATCGGCGCTGACGATGCCCTGGTGACGCGCCTCGCCTCGGCGCTGGGGGGC
GCGGGAGCCGACGTACGGGTCGTCACCGTCGGTGACCCGGGGGCGGACTCGTACGACGAC
CTCGCCGCCGAAGTGTCGTCCCTGACGGCGGACGGCGGTGAGCTCGCGGGGGTCCTGTCG
TTGCTCGGCCTCGCTTCGGCGGACGGTCCCGGGGATGCCCGGGAGGCGGCCGTCGGCACG
CTGGCGCTGCTGCGTGCCCTGTCCGGGTCCGTTGCGTCCGTGCCCGTGTGGTCCCTGACC
TCGGGCGCCGTATCGACGGGCGGCTCGGAGCGGGTGAGCGCTCCCGCCCAGGCCGTGCTG
TGGGGTCTGGGCCGACTGCTCGCGGAGGACTCCGACGTGCGCTGGGCCGGTGTCGTCGAC
GTACCCGCCCCATGCGGTGACCGTGTGCTGAGGCGGCTGGCCGAGGTGCTGGCGAACCCG
GCCGAGGAGACCGAGGTGGCCGTGCGTGACGCGGGTGTGTTCGCCCGGCGGCTCCTCAGG
GCGACCGGTGCGGCCGACGGCCCGGCCAGGCCCACCGCACTCGCGCCGCGCGGCACGCTC
CTGGTGAGCGGCGGCAGCGACACCTGGCGGGACCGGGTGGCCCGCCGTCTGCTCGCCTCC
GGTGCGGCGCACGTCCTGGTGGCCACCGCGCCGGACGAGCCGGAACCCGCGAGCACGCCG
GGATCCGCCGTGACCGGGGTCAGCCGAGTCGTCTGCGACGTCTCCGACGGCCCCGCGCTG
GCCCACCTCGCCGCATCGCTGCCCGCCGGGCCCGACGGGCGTCCTCTGACGGGCGTGGTG
CACGCGCCGCCCGCCACCGCGTCCGACGGCCCGTTGGACAAGGCGCTCGACGAAGTGCTG
GGCGCCGGCCTCCCCGCTCTGGCCGGCGTTTCCAGCACCGCGGGCCCGATCGCCCTGTTC
CTCGCCGTGGACGTGGACGACCTGGTCGGCGCCCCGGGCGCGGGTGCCGTGGCGGCGCTG
GCCGGCTGGTGGGAGGCCGCGGCCCGGGTACGGACCGCCGACCGGGCGCCGGTACGTCTG
ATCGCCGCCGACCCCGACGCACTCGACCTCGCCGTGCTGGACCGGGCCATGGAACGGGCG
GACGGGCTGCTGGTCGTCACGGGGCGGGACTGGGCGCAGTACGCCGGCACGCACGCGGAC
ACCCGCGGCAGGCGCCTCCTGGAGGGTGTCCCCGAGGCGCGGGCGGTGCTGGCCGCGGCG
GCCCCGGCCGGGGATGCGGGGAAGTCCGGCCTGCTGGCCGGGGTCGACGGACCCGAGTCG
CTGCGCCGTGTCCTCGCCGCCCGGGAGGCCGACCACAAGCTGGCGACACTGGTGGAGCTG
GTGCGCGGTCAGGTCGCCGTCGTTCTCGGGCACGCGTCGGCCGACGCCGTGTCCGCCGAC
GGCGACTTCATGGACCTGGGGTTCGCCTCGCTCACCGCGGTCGAGTTCGGGCACCGCCTC
TCCGCGATCACCGGGCTGAAACTGCCCACCACCCTGGTTTACGACCACCTCAACCCGGTC
GAACTCGCCGAGCACCTCGCGGACGAACTCGCCCGCGAGCTCACCGCCGCCTGA
[6] KS35..410
[6] AT560..865
[6] malonyl-CoA749..753
[6] DH917..1084
[6] KR1388..1564
[6] ACP1676..1746
[7] KS1768..2143
[7] AT2293..2606
[7] malonyl-CoA2482..2486
[7] kr2938..3038
[7] ACP3197..3267
[6] KS103..1230
[6] AT1678..2595
[6] malonyl-CoA2245..2259
[6] DH2749..3252
[6] KR4162..4692
[6] ACP5026..5238
[7] KS5302..6429
[7] AT6877..7818
[7] malonyl-CoA7444..7458
[7] kr8812..9114
[7] ACP9589..9801

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [559-681]  G3DSA:3.40.366.10 [749-861]  G3DSA:3.40.366.10 [2282-2414]  G3DSA:3.40.366.10 [2482-2596]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2938-3038]  2.6e-06 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1704-1719]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1669-1784]  4.90001027782405e-28 SSF47336 [3188-3273]  2.90000354677981e-17 SSF47336
SSF47336   ACP_like
 [1675-1749]  1.40000000000001e-40 G3DSA:1.10.1200.10 [3197-3271]  1.40000000000001e-40 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1679-1745]  1e-13 PF00550 [3201-3266]  1e-07 PF00550
PF00550   PP-binding
 [1676-1746]  PS50075 [3197-3267]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1388-1563]  2.29999999999998e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  1.39999999999997e-102 PF00109 [1768-2018]  5.50000000000008e-102 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-410]  2.89999999999999e-47 PF02801 [2026-2143]  1.09999999999999e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [560-865]  2.99999999999998e-64 PF00698 [2293-2606]  5.80000000000004e-65 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [558-858]  3.30001976117415e-76 SSF52151 [2290-2590]  9.30000048475962e-77 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [683-748]  6.59999852526376e-17 SSF55048 [2416-2481]  5.59999989417023e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  G3DSA:3.40.47.10 [298-463]  G3DSA:3.40.47.10 [1767-2029]  G3DSA:3.40.47.10 [2030-2196]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-463]  1.50000965748778e-105 SSF53901 [1760-2196]  7.90003079443025e-107 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1390-1570]  1.09999999999999e-34 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606 [1931-1947]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [561-852]  SM00827 [2294-2587]  SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1677-1749]  1.60000240695997e-34 SM00823 [3198-3270]  6.19998763505952e-25 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [917-1084]  5.39997012872478e-83 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825 [1770-2196]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1388-1564]  2.50000909916183e-52 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit