close all open/close all

CDS information : Alip_00170


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction55,363 / 56,112 / + [in whole cluster]
55,363 / 56,112 / + [in contig]
Location55363..56112 [in whole cluster]
55363..56112 [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)LipTe
Gene
Gene (GenBank)lipTe
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • putative type II thioesterase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [LipTe]
MTSAVDTGVWIRRYRPAPDAGVRLLCLPHAGGAASYYVPVAAALAPAADVLAVQYPGRQD
RRSEEPLGDLRELADRVADAVGDGDERPLAVFGHSMGALLGYEVALRLEEAGRGPVRLFV
SGRRAPSAVRPSEDMHKRTDSALLDGVRRLSGTDAQVFEDEELVRMVLPAIRADYRAVET
YEPRPGDRVRCPVTVLTGDDDPMATVEEARAWSAHTEGPTDLHVFPGGHFYLNDRAADVL
TVVRAHLGL
selected fasta
>putative type II thioesterase [LipTe]
ATGACCTCCGCAGTGGACACCGGCGTCTGGATACGCCGTTACCGGCCCGCCCCCGACGCG
GGAGTCCGCTTGCTGTGCCTTCCGCACGCCGGCGGCGCGGCCAGCTACTACGTGCCCGTG
GCCGCCGCGCTCGCGCCCGCCGCCGACGTGCTCGCCGTGCAGTACCCCGGGCGTCAGGAC
CGCCGCTCCGAGGAACCGCTCGGAGATCTACGGGAGTTGGCGGACCGGGTCGCCGACGCG
GTGGGTGACGGCGACGAGCGGCCCCTCGCGGTGTTCGGGCACAGCATGGGTGCACTCCTC
GGCTACGAGGTGGCGCTCCGGCTGGAGGAGGCCGGGCGCGGCCCGGTGCGGCTGTTCGTG
TCGGGGCGGCGCGCGCCGAGCGCGGTCCGGCCCAGCGAGGACATGCACAAGCGCACCGAC
AGCGCCCTGCTGGACGGGGTGCGCCGGCTCAGCGGCACCGACGCGCAGGTGTTCGAGGAC
GAGGAGCTGGTGCGGATGGTGCTGCCCGCGATCCGCGCCGACTACCGCGCCGTGGAGACG
TACGAGCCGCGTCCCGGCGACCGGGTGCGCTGCCCGGTGACCGTGCTGACGGGCGACGAC
GACCCCATGGCGACGGTGGAGGAGGCCCGCGCCTGGTCCGCCCACACCGAGGGTCCCACC
GACCTGCATGTCTTCCCCGGGGGGCACTTCTACCTCAACGACCGCGCGGCGGACGTCCTC
ACCGTCGTCCGGGCCCACTTGGGTCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [23-243]  1e-58 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit